Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XTG8

Protein Details
Accession G1XTG8    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-38SSPEPEPKPKRRRIVTPREEBasic
NLS Segment(s)
PositionSequence
25-31PKPKRRR
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MNSSVKIKRKRPIVIEIESSPEPEPKPKRRRIVTPREEEEDYGDGYFVSPTQRLSALERLRMARGLLKTREPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.55
4 0.51
5 0.44
6 0.4
7 0.31
8 0.26
9 0.22
10 0.26
11 0.33
12 0.38
13 0.48
14 0.55
15 0.63
16 0.66
17 0.76
18 0.78
19 0.81
20 0.79
21 0.78
22 0.73
23 0.68
24 0.63
25 0.52
26 0.45
27 0.34
28 0.25
29 0.17
30 0.13
31 0.08
32 0.08
33 0.08
34 0.06
35 0.06
36 0.06
37 0.07
38 0.09
39 0.1
40 0.11
41 0.16
42 0.24
43 0.26
44 0.3
45 0.33
46 0.33
47 0.34
48 0.34
49 0.31
50 0.28
51 0.3
52 0.34
53 0.35