Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XHD9

Protein Details
Accession G1XHD9   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-48MTTVKHVPIVKKHKKRFNRHQSDRFKCVDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
11-17KKHKKRF
33-50RKPKGIDNRVRRRFKGQA
Subcellular Location(s) nucl 10.5, cyto_nucl 10.333, mito_nucl 10.166, mito 8.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTTVKHVPIVKKHKKRFNRHQSDRFKCVDASWRKPKGIDNRVRRRFKGQAAMPKIGYGSNKKTRHMTPSGHKAFLVHNVNDVDLLLMHNHTFAAEISHAVSSRKRIEIVAKAKALGVKVTNPKGRVTTDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.9
3 0.92
4 0.92
5 0.92
6 0.92
7 0.93
8 0.94
9 0.91
10 0.87
11 0.79
12 0.7
13 0.59
14 0.5
15 0.49
16 0.47
17 0.48
18 0.52
19 0.54
20 0.53
21 0.54
22 0.59
23 0.6
24 0.61
25 0.62
26 0.62
27 0.68
28 0.77
29 0.82
30 0.77
31 0.73
32 0.69
33 0.65
34 0.63
35 0.58
36 0.58
37 0.57
38 0.58
39 0.5
40 0.44
41 0.38
42 0.31
43 0.27
44 0.22
45 0.24
46 0.31
47 0.33
48 0.34
49 0.38
50 0.39
51 0.43
52 0.43
53 0.41
54 0.38
55 0.46
56 0.48
57 0.44
58 0.42
59 0.36
60 0.32
61 0.35
62 0.33
63 0.22
64 0.22
65 0.22
66 0.22
67 0.21
68 0.19
69 0.11
70 0.07
71 0.07
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.07
81 0.07
82 0.07
83 0.08
84 0.09
85 0.1
86 0.11
87 0.13
88 0.16
89 0.2
90 0.21
91 0.21
92 0.22
93 0.28
94 0.36
95 0.41
96 0.43
97 0.4
98 0.39
99 0.39
100 0.39
101 0.34
102 0.28
103 0.23
104 0.23
105 0.31
106 0.39
107 0.43
108 0.43
109 0.45
110 0.46