Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1WYB4

Protein Details
Accession G1WYB4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-25RQGGKAKPLKAPKKEKKELDDDBasic
NLS Segment(s)
PositionSequence
6-20GGKAKPLKAPKKEKK
Subcellular Location(s) mito 12, nucl 9, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MSGRQGGKAKPLKAPKKEKKELDDDDLAFKERQKKEAAELKAAQAKAGQKGPMGGSGIKKWAHATPEYIASTSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.76
3 0.79
4 0.86
5 0.84
6 0.8
7 0.8
8 0.75
9 0.7
10 0.65
11 0.55
12 0.49
13 0.42
14 0.38
15 0.29
16 0.27
17 0.29
18 0.25
19 0.27
20 0.27
21 0.27
22 0.31
23 0.38
24 0.38
25 0.34
26 0.33
27 0.33
28 0.34
29 0.33
30 0.27
31 0.22
32 0.22
33 0.21
34 0.22
35 0.2
36 0.16
37 0.18
38 0.19
39 0.18
40 0.18
41 0.17
42 0.17
43 0.18
44 0.23
45 0.21
46 0.22
47 0.22
48 0.23
49 0.25
50 0.24
51 0.26
52 0.24
53 0.3
54 0.31