Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XGL0

Protein Details
Accession G1XGL0    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-31SSQHNQSRKAHRNGIKKPKTHydrophilic
NLS Segment(s)
PositionSequence
19-57RKAHRNGIKKPKTFRYPSLKGTDPKFKRNHKHALHGTAK
Subcellular Location(s) nucl 18, mito 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MLTDTFTESKNSSQHNQSRKAHRNGIKKPKTFRYPSLKGTDPKFKRNHKHALHGTAKALKEFKAGLRETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.58
4 0.62
5 0.68
6 0.73
7 0.75
8 0.75
9 0.75
10 0.77
11 0.78
12 0.81
13 0.8
14 0.76
15 0.76
16 0.75
17 0.75
18 0.7
19 0.68
20 0.66
21 0.62
22 0.61
23 0.6
24 0.56
25 0.51
26 0.51
27 0.53
28 0.48
29 0.51
30 0.54
31 0.58
32 0.63
33 0.67
34 0.73
35 0.67
36 0.74
37 0.72
38 0.73
39 0.7
40 0.63
41 0.59
42 0.54
43 0.5
44 0.44
45 0.39
46 0.3
47 0.27
48 0.26
49 0.27
50 0.29