Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XDM4

Protein Details
Accession G1XDM4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MTRRKANHPTSPPQNPRPTHQSHRRQQSHPHTSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 9.832, cyto_nucl 8.333, nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010334  Dcp1  
IPR011993  PH-like_dom_sf  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0008047  F:enzyme activator activity  
GO:0000290  P:deadenylation-dependent decapping of nuclear-transcribed mRNA  
GO:0043085  P:positive regulation of catalytic activity  
Pfam View protein in Pfam  
PF06058  DCP1  
Amino Acid Sequences MTRRKANHPTSPPQNPRPTHQSHRRQQSHPHTSSGPSLQALHAVHDAPASLEQLNSLNFPVLQKFLPSLTRIHLTTSYSTAYKIRNGNWEKLDIEGPLFLLELLPSHPHFPSSSSSLNNLDPKMVEGMGKYHAFVLNRKGVNNLLIPLPKRIENVDTTNSVLISMLMAWEDCYGLSVFDQEGTSTASESERVGAKVLELVKEMEEIDESAAAAATAAAVAAAKEAENLRKRVENADRLQAELQVQPQWGQQQQQVPQQVPQQIPQMLHHPHHPHHPQMSQHLPPLQMQHLHHQQQYSGSPAYMTPTAEYAGVDLMAALGPKLGIVGTGNSNGGGGNNSGYNSGDGGYTSAASGAGGKGRKITLNELFGKPLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.77
3 0.76
4 0.76
5 0.74
6 0.74
7 0.75
8 0.76
9 0.76
10 0.84
11 0.85
12 0.81
13 0.84
14 0.84
15 0.84
16 0.76
17 0.72
18 0.63
19 0.58
20 0.58
21 0.5
22 0.41
23 0.32
24 0.3
25 0.25
26 0.28
27 0.25
28 0.22
29 0.21
30 0.19
31 0.17
32 0.16
33 0.16
34 0.12
35 0.12
36 0.11
37 0.1
38 0.09
39 0.1
40 0.12
41 0.12
42 0.12
43 0.11
44 0.11
45 0.11
46 0.12
47 0.13
48 0.14
49 0.13
50 0.13
51 0.14
52 0.16
53 0.18
54 0.18
55 0.19
56 0.2
57 0.24
58 0.23
59 0.25
60 0.25
61 0.24
62 0.25
63 0.25
64 0.24
65 0.2
66 0.22
67 0.22
68 0.22
69 0.26
70 0.28
71 0.29
72 0.37
73 0.41
74 0.47
75 0.45
76 0.46
77 0.4
78 0.38
79 0.35
80 0.25
81 0.21
82 0.15
83 0.12
84 0.09
85 0.09
86 0.07
87 0.05
88 0.05
89 0.05
90 0.06
91 0.08
92 0.08
93 0.1
94 0.11
95 0.12
96 0.12
97 0.14
98 0.16
99 0.19
100 0.22
101 0.21
102 0.24
103 0.26
104 0.29
105 0.3
106 0.27
107 0.23
108 0.19
109 0.19
110 0.18
111 0.15
112 0.12
113 0.09
114 0.1
115 0.13
116 0.13
117 0.12
118 0.12
119 0.14
120 0.15
121 0.17
122 0.21
123 0.24
124 0.25
125 0.26
126 0.26
127 0.24
128 0.26
129 0.24
130 0.2
131 0.15
132 0.17
133 0.17
134 0.19
135 0.19
136 0.18
137 0.18
138 0.18
139 0.18
140 0.19
141 0.22
142 0.22
143 0.21
144 0.21
145 0.2
146 0.18
147 0.16
148 0.12
149 0.08
150 0.05
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.03
157 0.04
158 0.03
159 0.04
160 0.04
161 0.04
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.05
168 0.05
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.06
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.07
182 0.1
183 0.11
184 0.1
185 0.09
186 0.09
187 0.09
188 0.1
189 0.1
190 0.07
191 0.06
192 0.06
193 0.05
194 0.05
195 0.04
196 0.04
197 0.04
198 0.03
199 0.03
200 0.02
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.02
207 0.02
208 0.02
209 0.02
210 0.04
211 0.05
212 0.12
213 0.16
214 0.18
215 0.2
216 0.23
217 0.24
218 0.3
219 0.36
220 0.38
221 0.37
222 0.44
223 0.42
224 0.41
225 0.4
226 0.34
227 0.29
228 0.22
229 0.21
230 0.15
231 0.15
232 0.14
233 0.15
234 0.17
235 0.17
236 0.18
237 0.2
238 0.24
239 0.28
240 0.34
241 0.36
242 0.34
243 0.35
244 0.38
245 0.4
246 0.35
247 0.33
248 0.32
249 0.31
250 0.31
251 0.29
252 0.31
253 0.29
254 0.3
255 0.34
256 0.34
257 0.33
258 0.42
259 0.44
260 0.43
261 0.45
262 0.48
263 0.44
264 0.46
265 0.52
266 0.45
267 0.45
268 0.42
269 0.38
270 0.35
271 0.36
272 0.32
273 0.3
274 0.29
275 0.34
276 0.4
277 0.43
278 0.44
279 0.4
280 0.38
281 0.37
282 0.37
283 0.32
284 0.24
285 0.2
286 0.18
287 0.17
288 0.2
289 0.17
290 0.16
291 0.13
292 0.13
293 0.13
294 0.13
295 0.13
296 0.1
297 0.08
298 0.08
299 0.07
300 0.05
301 0.05
302 0.05
303 0.05
304 0.04
305 0.04
306 0.04
307 0.04
308 0.04
309 0.04
310 0.04
311 0.05
312 0.07
313 0.09
314 0.11
315 0.12
316 0.11
317 0.12
318 0.11
319 0.11
320 0.1
321 0.08
322 0.08
323 0.09
324 0.1
325 0.11
326 0.12
327 0.12
328 0.11
329 0.11
330 0.09
331 0.09
332 0.09
333 0.09
334 0.08
335 0.08
336 0.08
337 0.07
338 0.07
339 0.08
340 0.08
341 0.13
342 0.14
343 0.15
344 0.18
345 0.2
346 0.25
347 0.27
348 0.34
349 0.35
350 0.42
351 0.47
352 0.46