Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GY31

Protein Details
Accession Q2GY31    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
130-149IGEKPGPGCKRRRRSVGSKABasic
NLS Segment(s)
PositionSequence
135-148GPGCKRRRRSVGSK
Subcellular Location(s) cyto 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001000  GH10_dom  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0031176  F:endo-1,4-beta-xylanase activity  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00331  Glyco_hydro_10  
PROSITE View protein in PROSITE  
PS51760  GH10_2  
Amino Acid Sequences MLKDAGVRIDGVGMQAHLHADNHPTAEDLIATSEGYAALVDEVAFTELDVRIKTPVNDTKLEWQKECYQKVVTACVKVKACVGITLWDFYDPFSWVPDVFPGNGASLVWFEDFSKHPAYDGMVETFKKLIGEKPGPGCKRRRRSVGSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.09
4 0.09
5 0.09
6 0.1
7 0.12
8 0.13
9 0.14
10 0.13
11 0.13
12 0.13
13 0.12
14 0.11
15 0.08
16 0.08
17 0.08
18 0.08
19 0.07
20 0.06
21 0.06
22 0.06
23 0.05
24 0.04
25 0.03
26 0.04
27 0.03
28 0.03
29 0.04
30 0.04
31 0.04
32 0.04
33 0.05
34 0.06
35 0.07
36 0.08
37 0.08
38 0.09
39 0.11
40 0.11
41 0.16
42 0.21
43 0.24
44 0.25
45 0.26
46 0.34
47 0.41
48 0.42
49 0.37
50 0.34
51 0.39
52 0.44
53 0.44
54 0.37
55 0.3
56 0.3
57 0.3
58 0.34
59 0.28
60 0.25
61 0.25
62 0.27
63 0.26
64 0.24
65 0.24
66 0.18
67 0.17
68 0.14
69 0.13
70 0.11
71 0.12
72 0.12
73 0.12
74 0.11
75 0.1
76 0.1
77 0.1
78 0.08
79 0.08
80 0.08
81 0.09
82 0.08
83 0.09
84 0.1
85 0.1
86 0.09
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.08
93 0.07
94 0.08
95 0.07
96 0.07
97 0.06
98 0.09
99 0.11
100 0.14
101 0.17
102 0.16
103 0.16
104 0.16
105 0.18
106 0.18
107 0.19
108 0.19
109 0.19
110 0.19
111 0.2
112 0.19
113 0.18
114 0.16
115 0.15
116 0.17
117 0.23
118 0.27
119 0.31
120 0.4
121 0.49
122 0.53
123 0.59
124 0.65
125 0.67
126 0.73
127 0.77
128 0.78
129 0.78