Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XPR2

Protein Details
Accession G1XPR2    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
148-167RENLPEFKKKVRKCVRDSLEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 10.833, cyto_nucl 9.833, mito 7.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000608  UBQ-conjugat_E2  
IPR023313  UBQ-conjugating_AS  
IPR016135  UBQ-conjugating_enzyme/RWD  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016740  F:transferase activity  
Pfam View protein in Pfam  
PF00179  UQ_con  
PROSITE View protein in PROSITE  
PS00183  UBC_1  
PS50127  UBC_2  
CDD cd00195  UBCc  
Amino Acid Sequences MSSAPASAHLLKRQLKEMQNNKDIPGISCGLHKDNIYDWEVMLMVSDDVKYYGGGFFKARLIFPKEYPLMPPEMKFESPIWHPNIYPEGKVCISILHPPEEDKYGYESAAERWLPVHTPETILVSVLSMLSSPNDESPANLDAAKMWRENLPEFKKKVRKCVRDSLEDAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.53
3 0.59
4 0.64
5 0.66
6 0.68
7 0.67
8 0.62
9 0.58
10 0.52
11 0.42
12 0.37
13 0.29
14 0.21
15 0.22
16 0.23
17 0.21
18 0.23
19 0.21
20 0.19
21 0.2
22 0.23
23 0.23
24 0.21
25 0.18
26 0.16
27 0.16
28 0.14
29 0.11
30 0.08
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.05
38 0.05
39 0.07
40 0.07
41 0.09
42 0.09
43 0.1
44 0.13
45 0.14
46 0.14
47 0.16
48 0.22
49 0.23
50 0.23
51 0.29
52 0.27
53 0.26
54 0.27
55 0.24
56 0.23
57 0.21
58 0.21
59 0.18
60 0.2
61 0.19
62 0.2
63 0.19
64 0.17
65 0.19
66 0.23
67 0.23
68 0.21
69 0.21
70 0.2
71 0.25
72 0.23
73 0.21
74 0.16
75 0.16
76 0.15
77 0.16
78 0.14
79 0.1
80 0.1
81 0.14
82 0.15
83 0.14
84 0.14
85 0.15
86 0.16
87 0.17
88 0.17
89 0.13
90 0.15
91 0.13
92 0.13
93 0.13
94 0.12
95 0.12
96 0.16
97 0.15
98 0.11
99 0.12
100 0.13
101 0.13
102 0.14
103 0.15
104 0.11
105 0.12
106 0.13
107 0.15
108 0.14
109 0.13
110 0.12
111 0.1
112 0.09
113 0.07
114 0.07
115 0.04
116 0.04
117 0.04
118 0.06
119 0.07
120 0.07
121 0.1
122 0.1
123 0.1
124 0.14
125 0.15
126 0.14
127 0.14
128 0.13
129 0.13
130 0.17
131 0.19
132 0.16
133 0.16
134 0.18
135 0.22
136 0.26
137 0.34
138 0.39
139 0.45
140 0.49
141 0.58
142 0.65
143 0.66
144 0.73
145 0.74
146 0.76
147 0.75
148 0.81
149 0.79
150 0.77