Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XPW4

Protein Details
Accession G1XPW4   
Localization Confidence Low
Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-113LAFRVEYQKKEKIKRNRPLSHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 14.5, nucl 12.5, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MWLPKDLVYEGGSSGIPGVYQNNLRGQTDLPTDKASDIYGFMQIVELSEYFTRFTAYITDKGFIEHREPRHEDGPPAQTLDSITTDIFKLRGNLAFRVEYQKKEKIKRNRPLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.07
4 0.07
5 0.08
6 0.1
7 0.12
8 0.15
9 0.2
10 0.22
11 0.23
12 0.23
13 0.22
14 0.22
15 0.26
16 0.26
17 0.22
18 0.21
19 0.21
20 0.2
21 0.2
22 0.17
23 0.12
24 0.11
25 0.1
26 0.1
27 0.09
28 0.08
29 0.08
30 0.07
31 0.07
32 0.07
33 0.06
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.07
41 0.07
42 0.09
43 0.12
44 0.15
45 0.15
46 0.16
47 0.15
48 0.16
49 0.17
50 0.15
51 0.17
52 0.2
53 0.21
54 0.27
55 0.3
56 0.33
57 0.35
58 0.35
59 0.33
60 0.32
61 0.33
62 0.28
63 0.26
64 0.22
65 0.19
66 0.18
67 0.18
68 0.15
69 0.12
70 0.11
71 0.1
72 0.11
73 0.11
74 0.11
75 0.1
76 0.11
77 0.12
78 0.18
79 0.19
80 0.22
81 0.25
82 0.26
83 0.26
84 0.35
85 0.36
86 0.37
87 0.41
88 0.47
89 0.52
90 0.6
91 0.68
92 0.69
93 0.77