Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XRH7

Protein Details
Accession G1XRH7    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
96-121REEWFRKKLEKAEKIKRRKEQEDAAABasic
NLS Segment(s)
PositionSequence
101-114RKKLEKAEKIKRRK
Subcellular Location(s) nucl 15, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MVRPVQNPSGSLPDPEQARYHLPSSNPLPLSSAQESQVRDQYYANVRAICAEEIRRYAECARGRTFSMVWKCREQQRIMNGCMVLNATQEEQDRAREEWFRKKLEKAEKIKRRKEQEDAAAATGKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.29
3 0.27
4 0.23
5 0.26
6 0.27
7 0.27
8 0.26
9 0.25
10 0.3
11 0.32
12 0.37
13 0.33
14 0.3
15 0.31
16 0.28
17 0.33
18 0.3
19 0.27
20 0.22
21 0.25
22 0.27
23 0.27
24 0.3
25 0.25
26 0.23
27 0.22
28 0.24
29 0.26
30 0.29
31 0.27
32 0.23
33 0.21
34 0.22
35 0.23
36 0.18
37 0.14
38 0.12
39 0.12
40 0.13
41 0.15
42 0.14
43 0.15
44 0.15
45 0.21
46 0.23
47 0.25
48 0.26
49 0.25
50 0.26
51 0.25
52 0.25
53 0.24
54 0.29
55 0.3
56 0.31
57 0.34
58 0.36
59 0.42
60 0.47
61 0.44
62 0.41
63 0.46
64 0.49
65 0.46
66 0.46
67 0.39
68 0.33
69 0.31
70 0.26
71 0.16
72 0.1
73 0.1
74 0.08
75 0.09
76 0.1
77 0.12
78 0.12
79 0.15
80 0.17
81 0.17
82 0.19
83 0.24
84 0.28
85 0.36
86 0.42
87 0.45
88 0.47
89 0.51
90 0.57
91 0.62
92 0.67
93 0.67
94 0.72
95 0.76
96 0.82
97 0.87
98 0.87
99 0.87
100 0.84
101 0.82
102 0.8
103 0.79
104 0.77
105 0.7
106 0.63