Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1X2T5

Protein Details
Accession G1X2T5    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
67-89TATPRITDKSRRKRLSQDQQHPLHydrophilic
102-121PGAQQHKRPRRRYEEIERMYBasic
NLS Segment(s)
PositionSequence
160-169RKEWKQRKKE
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MAASSPPYTQGSQYSPYPPQPGHDISQAGYPPQHTGWRPEWGQYHPSVPQQYTSPTASVSNQSSPTTATPRITDKSRRKRLSQDQQHPLAQQQQVYSFVPIPGAQQHKRPRRRYEEIERMYKCGWNGCEKAYGTLNHLNAHVTMQSHGVKRTPEEFKEIRKEWKQRKKEEEAAKKQEEEQARQQQRQLDGLSSMDNNTPTASGQYNNVPQQRQLPPPGYSQPPMQPGMHHYTQQAAGNLEQLQRFNPPTANMYGAYPHGAYAHAPSHHLYQPRQPPGAEEPDADADADPDVPSASYTHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.37
3 0.4
4 0.43
5 0.39
6 0.38
7 0.4
8 0.41
9 0.39
10 0.38
11 0.35
12 0.3
13 0.35
14 0.33
15 0.27
16 0.25
17 0.22
18 0.2
19 0.21
20 0.27
21 0.23
22 0.29
23 0.32
24 0.38
25 0.38
26 0.41
27 0.43
28 0.4
29 0.43
30 0.38
31 0.38
32 0.34
33 0.39
34 0.38
35 0.35
36 0.33
37 0.3
38 0.31
39 0.31
40 0.3
41 0.24
42 0.21
43 0.22
44 0.21
45 0.24
46 0.24
47 0.23
48 0.24
49 0.24
50 0.23
51 0.23
52 0.25
53 0.25
54 0.25
55 0.23
56 0.23
57 0.27
58 0.31
59 0.35
60 0.42
61 0.48
62 0.57
63 0.66
64 0.69
65 0.69
66 0.75
67 0.81
68 0.82
69 0.82
70 0.81
71 0.78
72 0.78
73 0.75
74 0.65
75 0.57
76 0.52
77 0.43
78 0.34
79 0.27
80 0.23
81 0.23
82 0.23
83 0.23
84 0.16
85 0.15
86 0.14
87 0.13
88 0.12
89 0.15
90 0.21
91 0.21
92 0.28
93 0.38
94 0.48
95 0.57
96 0.65
97 0.69
98 0.71
99 0.78
100 0.79
101 0.79
102 0.8
103 0.77
104 0.77
105 0.69
106 0.62
107 0.55
108 0.47
109 0.37
110 0.3
111 0.26
112 0.23
113 0.23
114 0.22
115 0.25
116 0.24
117 0.25
118 0.24
119 0.23
120 0.21
121 0.24
122 0.24
123 0.2
124 0.2
125 0.19
126 0.16
127 0.16
128 0.12
129 0.08
130 0.08
131 0.1
132 0.13
133 0.13
134 0.14
135 0.15
136 0.15
137 0.16
138 0.21
139 0.22
140 0.2
141 0.25
142 0.27
143 0.3
144 0.38
145 0.39
146 0.41
147 0.45
148 0.53
149 0.57
150 0.65
151 0.69
152 0.7
153 0.76
154 0.76
155 0.78
156 0.78
157 0.79
158 0.78
159 0.78
160 0.71
161 0.63
162 0.57
163 0.53
164 0.46
165 0.4
166 0.4
167 0.42
168 0.45
169 0.45
170 0.47
171 0.46
172 0.44
173 0.42
174 0.34
175 0.25
176 0.21
177 0.2
178 0.18
179 0.14
180 0.13
181 0.11
182 0.11
183 0.1
184 0.09
185 0.09
186 0.08
187 0.1
188 0.1
189 0.09
190 0.11
191 0.15
192 0.2
193 0.25
194 0.29
195 0.27
196 0.28
197 0.35
198 0.38
199 0.39
200 0.39
201 0.38
202 0.36
203 0.4
204 0.43
205 0.4
206 0.36
207 0.35
208 0.35
209 0.35
210 0.36
211 0.31
212 0.28
213 0.29
214 0.34
215 0.33
216 0.29
217 0.26
218 0.26
219 0.28
220 0.29
221 0.26
222 0.2
223 0.18
224 0.2
225 0.21
226 0.21
227 0.2
228 0.18
229 0.17
230 0.2
231 0.21
232 0.21
233 0.21
234 0.2
235 0.23
236 0.24
237 0.25
238 0.22
239 0.21
240 0.2
241 0.19
242 0.19
243 0.15
244 0.13
245 0.11
246 0.11
247 0.11
248 0.13
249 0.17
250 0.16
251 0.18
252 0.19
253 0.24
254 0.28
255 0.33
256 0.32
257 0.37
258 0.46
259 0.52
260 0.53
261 0.48
262 0.48
263 0.49
264 0.54
265 0.46
266 0.38
267 0.34
268 0.34
269 0.34
270 0.3
271 0.23
272 0.16
273 0.14
274 0.14
275 0.1
276 0.08
277 0.08
278 0.07
279 0.08