Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XFP5

Protein Details
Accession G1XFP5    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-44HETPADWKPIKKRPRYTPSKESLAYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito 11.5, cyto_mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003837  Asp/Glu-ADT_csu  
IPR036113  Asp/Glu-ADT_sf_sub_c  
Gene Ontology GO:0006450  P:regulation of translational fidelity  
Pfam View protein in Pfam  
PF02686  Glu-tRNAGln  
Amino Acid Sequences MSIRRSTIRLFSTTVRRLQHETPADWKPIKKRPRYTPSKESLAYVEAILEKPTWSITELLPPSHPKSTSNTPPPDPKDLITPEKLKHLLRLSALPMPKDQQEEDEMIKDLNDQLYFVNKIKEVDVTGVEPLVAIRDESEERGITLEDVLQAEKEAEAFGPMGREEWDPLKQVKNKLGRYIVVEGEMGEGPAVDDELVVSAGEVKKVNSLGTVETTGTETR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.47
4 0.5
5 0.5
6 0.53
7 0.49
8 0.46
9 0.47
10 0.47
11 0.5
12 0.48
13 0.5
14 0.5
15 0.53
16 0.6
17 0.64
18 0.69
19 0.74
20 0.8
21 0.86
22 0.86
23 0.87
24 0.84
25 0.82
26 0.73
27 0.63
28 0.55
29 0.46
30 0.37
31 0.27
32 0.21
33 0.14
34 0.14
35 0.13
36 0.11
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.1
43 0.09
44 0.17
45 0.18
46 0.19
47 0.21
48 0.25
49 0.27
50 0.29
51 0.29
52 0.23
53 0.28
54 0.35
55 0.42
56 0.47
57 0.48
58 0.48
59 0.56
60 0.58
61 0.58
62 0.51
63 0.42
64 0.4
65 0.39
66 0.4
67 0.36
68 0.36
69 0.31
70 0.35
71 0.38
72 0.32
73 0.32
74 0.31
75 0.29
76 0.26
77 0.27
78 0.24
79 0.25
80 0.26
81 0.22
82 0.2
83 0.19
84 0.19
85 0.19
86 0.17
87 0.14
88 0.15
89 0.16
90 0.16
91 0.15
92 0.13
93 0.11
94 0.11
95 0.1
96 0.08
97 0.07
98 0.06
99 0.06
100 0.06
101 0.08
102 0.1
103 0.1
104 0.11
105 0.11
106 0.12
107 0.12
108 0.12
109 0.11
110 0.1
111 0.1
112 0.09
113 0.09
114 0.08
115 0.07
116 0.06
117 0.06
118 0.05
119 0.04
120 0.04
121 0.04
122 0.06
123 0.07
124 0.08
125 0.1
126 0.09
127 0.09
128 0.1
129 0.1
130 0.08
131 0.07
132 0.07
133 0.06
134 0.07
135 0.07
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.04
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.07
149 0.09
150 0.09
151 0.11
152 0.13
153 0.16
154 0.18
155 0.2
156 0.28
157 0.31
158 0.36
159 0.42
160 0.48
161 0.5
162 0.54
163 0.55
164 0.49
165 0.48
166 0.47
167 0.4
168 0.32
169 0.28
170 0.21
171 0.2
172 0.17
173 0.12
174 0.08
175 0.07
176 0.06
177 0.06
178 0.06
179 0.04
180 0.03
181 0.04
182 0.04
183 0.05
184 0.05
185 0.04
186 0.09
187 0.1
188 0.12
189 0.13
190 0.13
191 0.16
192 0.17
193 0.18
194 0.15
195 0.16
196 0.16
197 0.19
198 0.2
199 0.17
200 0.17