Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XA31

Protein Details
Accession G1XA31    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-103EAAPKDKKPKPWPPFRGGRDBasic
NLS Segment(s)
PositionSequence
85-107AAPKDKKPKPWPPFRGGRDIWKR
Subcellular Location(s) extr 21, mito 3, E.R. 1, golg 1, vacu 1
Family & Domain DBs
Amino Acid Sequences MKVNLIFSLLLLGAFTAAAPADWKRQDSPGLDGTPTPGSTVDRDWGPGNPPDVWKREADAAPKSGPITKPDWEPSHPGHIWNREAAPKDKKPKPWPPFRGGRDIWKRGRTYNPLNVKGFYQGGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.03
4 0.03
5 0.03
6 0.05
7 0.07
8 0.13
9 0.15
10 0.18
11 0.2
12 0.22
13 0.27
14 0.27
15 0.3
16 0.3
17 0.29
18 0.27
19 0.26
20 0.26
21 0.23
22 0.21
23 0.17
24 0.12
25 0.12
26 0.13
27 0.14
28 0.14
29 0.12
30 0.14
31 0.14
32 0.14
33 0.16
34 0.16
35 0.17
36 0.16
37 0.19
38 0.21
39 0.23
40 0.23
41 0.21
42 0.2
43 0.23
44 0.23
45 0.24
46 0.22
47 0.22
48 0.2
49 0.21
50 0.2
51 0.18
52 0.17
53 0.17
54 0.18
55 0.17
56 0.2
57 0.24
58 0.27
59 0.26
60 0.29
61 0.28
62 0.33
63 0.31
64 0.32
65 0.32
66 0.34
67 0.33
68 0.31
69 0.31
70 0.27
71 0.31
72 0.34
73 0.38
74 0.41
75 0.49
76 0.53
77 0.61
78 0.67
79 0.74
80 0.77
81 0.8
82 0.8
83 0.78
84 0.82
85 0.77
86 0.77
87 0.69
88 0.7
89 0.69
90 0.7
91 0.69
92 0.66
93 0.65
94 0.61
95 0.67
96 0.65
97 0.63
98 0.64
99 0.67
100 0.67
101 0.67
102 0.63
103 0.55
104 0.51