Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1X4N5

Protein Details
Accession G1X4N5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
114-139LEEKVISPPKRRRRKSTSARRDQIPSHydrophilic
NLS Segment(s)
PositionSequence
102-132PRDWKIPKRRPVLEEKVISPPKRRRRKSTSA
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038491  Velvet_dom_sf  
Amino Acid Sequences MPPRKKVNSGREVSQSVSQSIVPEHSHKKRCWDLVDAPSLSRSQGTGTIKMDPNSIHKPLRRSARLQVTAIPEQSEQEQNHTSSSLPNKFQRPRSKTVPTQPRDWKIPKRRPVLEEKVISPPKRRRRKSTSARRDQIPSLLPAITFEGEDIEGEESEVRDSDGVLWVKMPFVSPEDIYNFSAEFYIAPPRIVEVNTAVGPPPIIVRLHIVDKKTGQEVPYDNDPERYYWAMARVLHEDHTLCTEPEYQNKNQATETPMSWFHEEQEEDTRTPVTQTPPPGGPVRKWKTFVTFPGIQIPVVGKYRIMITLGVYIDQKLRAADGREKDEKVCKELVSTTSDVIIVQEEEPKDDDASDLLQKKDLYDKFLAERDEFFKREQNESY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.48
3 0.39
4 0.35
5 0.3
6 0.24
7 0.23
8 0.23
9 0.2
10 0.25
11 0.33
12 0.42
13 0.49
14 0.5
15 0.58
16 0.63
17 0.67
18 0.65
19 0.63
20 0.62
21 0.61
22 0.67
23 0.59
24 0.51
25 0.46
26 0.42
27 0.34
28 0.26
29 0.19
30 0.12
31 0.19
32 0.22
33 0.25
34 0.26
35 0.33
36 0.36
37 0.36
38 0.37
39 0.31
40 0.34
41 0.36
42 0.4
43 0.39
44 0.4
45 0.45
46 0.5
47 0.58
48 0.58
49 0.56
50 0.6
51 0.64
52 0.64
53 0.6
54 0.59
55 0.55
56 0.53
57 0.48
58 0.41
59 0.3
60 0.27
61 0.28
62 0.29
63 0.23
64 0.24
65 0.26
66 0.25
67 0.26
68 0.25
69 0.22
70 0.22
71 0.3
72 0.31
73 0.33
74 0.38
75 0.47
76 0.53
77 0.62
78 0.67
79 0.67
80 0.68
81 0.71
82 0.74
83 0.73
84 0.76
85 0.78
86 0.7
87 0.72
88 0.74
89 0.71
90 0.71
91 0.71
92 0.71
93 0.71
94 0.78
95 0.78
96 0.78
97 0.78
98 0.75
99 0.77
100 0.75
101 0.72
102 0.65
103 0.59
104 0.59
105 0.59
106 0.56
107 0.55
108 0.56
109 0.59
110 0.66
111 0.71
112 0.71
113 0.74
114 0.83
115 0.85
116 0.87
117 0.88
118 0.88
119 0.87
120 0.81
121 0.76
122 0.66
123 0.59
124 0.5
125 0.4
126 0.31
127 0.25
128 0.21
129 0.17
130 0.17
131 0.12
132 0.1
133 0.08
134 0.07
135 0.06
136 0.06
137 0.07
138 0.06
139 0.05
140 0.05
141 0.06
142 0.05
143 0.05
144 0.05
145 0.05
146 0.04
147 0.04
148 0.05
149 0.1
150 0.1
151 0.1
152 0.1
153 0.1
154 0.11
155 0.11
156 0.1
157 0.06
158 0.07
159 0.09
160 0.09
161 0.1
162 0.12
163 0.15
164 0.15
165 0.14
166 0.13
167 0.11
168 0.11
169 0.09
170 0.07
171 0.06
172 0.1
173 0.1
174 0.1
175 0.09
176 0.1
177 0.11
178 0.11
179 0.11
180 0.07
181 0.09
182 0.09
183 0.1
184 0.09
185 0.08
186 0.08
187 0.07
188 0.06
189 0.06
190 0.05
191 0.06
192 0.07
193 0.09
194 0.14
195 0.16
196 0.17
197 0.17
198 0.19
199 0.2
200 0.2
201 0.2
202 0.16
203 0.17
204 0.18
205 0.2
206 0.23
207 0.24
208 0.23
209 0.24
210 0.24
211 0.21
212 0.22
213 0.2
214 0.15
215 0.14
216 0.16
217 0.16
218 0.17
219 0.18
220 0.18
221 0.18
222 0.18
223 0.18
224 0.16
225 0.13
226 0.16
227 0.15
228 0.12
229 0.13
230 0.17
231 0.17
232 0.24
233 0.29
234 0.27
235 0.34
236 0.35
237 0.35
238 0.31
239 0.33
240 0.29
241 0.26
242 0.25
243 0.2
244 0.21
245 0.22
246 0.24
247 0.21
248 0.19
249 0.21
250 0.21
251 0.2
252 0.25
253 0.25
254 0.23
255 0.24
256 0.23
257 0.18
258 0.2
259 0.21
260 0.18
261 0.19
262 0.22
263 0.25
264 0.25
265 0.28
266 0.33
267 0.32
268 0.33
269 0.4
270 0.44
271 0.46
272 0.48
273 0.47
274 0.48
275 0.5
276 0.5
277 0.47
278 0.44
279 0.4
280 0.44
281 0.42
282 0.34
283 0.3
284 0.27
285 0.24
286 0.22
287 0.21
288 0.13
289 0.13
290 0.15
291 0.15
292 0.15
293 0.11
294 0.1
295 0.15
296 0.15
297 0.16
298 0.15
299 0.15
300 0.16
301 0.16
302 0.16
303 0.11
304 0.12
305 0.15
306 0.19
307 0.26
308 0.3
309 0.36
310 0.41
311 0.43
312 0.45
313 0.5
314 0.48
315 0.45
316 0.43
317 0.36
318 0.33
319 0.35
320 0.34
321 0.31
322 0.3
323 0.26
324 0.23
325 0.23
326 0.2
327 0.16
328 0.15
329 0.11
330 0.1
331 0.15
332 0.14
333 0.16
334 0.18
335 0.19
336 0.18
337 0.17
338 0.16
339 0.12
340 0.15
341 0.2
342 0.23
343 0.23
344 0.26
345 0.26
346 0.27
347 0.35
348 0.35
349 0.34
350 0.33
351 0.36
352 0.37
353 0.42
354 0.44
355 0.36
356 0.38
357 0.37
358 0.4
359 0.38
360 0.36
361 0.38
362 0.39