Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XRA3

Protein Details
Accession G1XRA3   
Localization Confidence Low
Confidence Score 5.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MFSYLQHRKNCKIKQQDRANRIASHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, cyto_mito 12.166, cyto_nucl 5.166, nucl 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR023631  Amidase_dom  
IPR036928  AS_sf  
Pfam View protein in Pfam  
PF01425  Amidase  
Amino Acid Sequences MFSYLQHRKNCKIKQQDRANRIASLPSYYSTPLTSQDRSILSTPIGTLASNIRNKEWAPIDVLRAYGKKSILAHEATNCLTEVMIKEMEEYVEGKEFTGPLAGVPISVKDTVSIKGFDYCIGYSSLVNKPALIDSPLTRLLKDAGCVPYVKTNVPITLLSFESTNDVFGRTSNPHNKDYSPGGSTGGESALLAYGGSRIGIGTDVAGSVRVPAHWAGIYTVRAATGRFMKSMNVSINAHMYLVLNTPRSGGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.87
4 0.84
5 0.84
6 0.77
7 0.67
8 0.6
9 0.54
10 0.44
11 0.38
12 0.32
13 0.25
14 0.24
15 0.23
16 0.23
17 0.19
18 0.19
19 0.2
20 0.24
21 0.25
22 0.24
23 0.27
24 0.27
25 0.29
26 0.29
27 0.25
28 0.21
29 0.19
30 0.18
31 0.15
32 0.15
33 0.11
34 0.11
35 0.14
36 0.2
37 0.24
38 0.25
39 0.24
40 0.26
41 0.27
42 0.31
43 0.3
44 0.24
45 0.25
46 0.25
47 0.28
48 0.25
49 0.26
50 0.23
51 0.21
52 0.22
53 0.2
54 0.19
55 0.19
56 0.19
57 0.21
58 0.23
59 0.24
60 0.24
61 0.22
62 0.25
63 0.22
64 0.21
65 0.18
66 0.14
67 0.11
68 0.1
69 0.09
70 0.09
71 0.09
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.09
78 0.07
79 0.09
80 0.09
81 0.08
82 0.09
83 0.08
84 0.08
85 0.08
86 0.07
87 0.05
88 0.06
89 0.06
90 0.05
91 0.05
92 0.06
93 0.07
94 0.07
95 0.07
96 0.07
97 0.08
98 0.09
99 0.11
100 0.11
101 0.1
102 0.11
103 0.12
104 0.11
105 0.12
106 0.1
107 0.1
108 0.1
109 0.1
110 0.09
111 0.12
112 0.13
113 0.14
114 0.14
115 0.13
116 0.12
117 0.12
118 0.12
119 0.1
120 0.09
121 0.08
122 0.11
123 0.16
124 0.16
125 0.15
126 0.15
127 0.16
128 0.15
129 0.15
130 0.16
131 0.13
132 0.14
133 0.14
134 0.14
135 0.17
136 0.18
137 0.18
138 0.17
139 0.17
140 0.16
141 0.18
142 0.17
143 0.13
144 0.14
145 0.14
146 0.11
147 0.1
148 0.1
149 0.11
150 0.1
151 0.1
152 0.08
153 0.09
154 0.09
155 0.09
156 0.12
157 0.13
158 0.21
159 0.29
160 0.33
161 0.35
162 0.37
163 0.38
164 0.38
165 0.4
166 0.35
167 0.28
168 0.24
169 0.23
170 0.21
171 0.21
172 0.17
173 0.13
174 0.09
175 0.07
176 0.07
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.04
184 0.04
185 0.03
186 0.04
187 0.05
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.05
194 0.05
195 0.06
196 0.07
197 0.06
198 0.08
199 0.08
200 0.11
201 0.11
202 0.11
203 0.12
204 0.15
205 0.16
206 0.15
207 0.15
208 0.14
209 0.14
210 0.14
211 0.16
212 0.19
213 0.21
214 0.21
215 0.21
216 0.23
217 0.26
218 0.31
219 0.3
220 0.28
221 0.28
222 0.28
223 0.31
224 0.28
225 0.25
226 0.2
227 0.17
228 0.14
229 0.17
230 0.19
231 0.18
232 0.17
233 0.18