Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XHX6

Protein Details
Accession G1XHX6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
31-50QHLPKPTRSIIKKRGPKRSTBasic
NLS Segment(s)
PositionSequence
36-52PTRSIIKKRGPKRSTGR
Subcellular Location(s) mito 19, nucl 6, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MASHKRSVSDSDILLRGKWAYGASLSRDLGQHLPKPTRSIIKKRGPKRSTGRSTHSRSITNKWKAFGLTESLLQRTIRSGCNQGIHHEDESGPPEILSAAFGLLKMQKEKDYIVLDVDPTVEKTPMGGMSAKSLGHALDPENAKRPVLLLFVSDLGREAGLYK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.23
4 0.19
5 0.18
6 0.14
7 0.11
8 0.13
9 0.15
10 0.18
11 0.22
12 0.23
13 0.23
14 0.23
15 0.24
16 0.26
17 0.28
18 0.29
19 0.31
20 0.35
21 0.35
22 0.39
23 0.4
24 0.45
25 0.48
26 0.53
27 0.57
28 0.62
29 0.7
30 0.75
31 0.82
32 0.75
33 0.76
34 0.76
35 0.76
36 0.75
37 0.73
38 0.71
39 0.7
40 0.75
41 0.72
42 0.67
43 0.62
44 0.56
45 0.57
46 0.6
47 0.6
48 0.54
49 0.48
50 0.46
51 0.4
52 0.38
53 0.31
54 0.25
55 0.16
56 0.17
57 0.17
58 0.17
59 0.17
60 0.16
61 0.15
62 0.13
63 0.14
64 0.13
65 0.14
66 0.16
67 0.17
68 0.21
69 0.22
70 0.22
71 0.23
72 0.24
73 0.22
74 0.2
75 0.18
76 0.14
77 0.16
78 0.15
79 0.11
80 0.09
81 0.09
82 0.08
83 0.08
84 0.07
85 0.05
86 0.04
87 0.04
88 0.04
89 0.05
90 0.07
91 0.09
92 0.1
93 0.12
94 0.13
95 0.15
96 0.16
97 0.2
98 0.2
99 0.19
100 0.19
101 0.18
102 0.16
103 0.15
104 0.15
105 0.11
106 0.1
107 0.11
108 0.09
109 0.08
110 0.08
111 0.1
112 0.09
113 0.11
114 0.11
115 0.1
116 0.13
117 0.15
118 0.15
119 0.14
120 0.14
121 0.12
122 0.11
123 0.12
124 0.1
125 0.15
126 0.19
127 0.21
128 0.27
129 0.28
130 0.27
131 0.25
132 0.25
133 0.21
134 0.2
135 0.18
136 0.13
137 0.14
138 0.16
139 0.17
140 0.16
141 0.14
142 0.12
143 0.12