Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1WY61

Protein Details
Accession G1WY61    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSYNGRKNPPRRRNYPKGPLTVNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, mito_nucl 12.5, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSYNGRKNPPRRRNYPKGPLTVNSMERHDSKYGHMVVLKVRTPVFSYISYTSRFGGFKVPKPPNQPTNQDLINIIMIKIYEINSQQSLLRKLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.9
3 0.86
4 0.83
5 0.77
6 0.69
7 0.66
8 0.61
9 0.55
10 0.47
11 0.41
12 0.37
13 0.34
14 0.36
15 0.3
16 0.25
17 0.22
18 0.26
19 0.24
20 0.23
21 0.22
22 0.2
23 0.21
24 0.24
25 0.23
26 0.18
27 0.18
28 0.17
29 0.17
30 0.18
31 0.18
32 0.14
33 0.16
34 0.17
35 0.19
36 0.2
37 0.19
38 0.18
39 0.17
40 0.16
41 0.14
42 0.2
43 0.22
44 0.26
45 0.35
46 0.4
47 0.43
48 0.5
49 0.56
50 0.56
51 0.58
52 0.58
53 0.51
54 0.51
55 0.47
56 0.41
57 0.35
58 0.28
59 0.24
60 0.19
61 0.16
62 0.11
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.13
69 0.16
70 0.17
71 0.18
72 0.21
73 0.26
74 0.32