Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2H3R0

Protein Details
Accession Q2H3R0    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MKKGKKKWRRHGHGWEPKAPGBasic
NLS Segment(s)
PositionSequence
2-18KKGKKKWRRHGHGWEPK
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
Amino Acid Sequences MKKGKKKWRRHGHGWEPKAPGTGDGSRSKIATAGHTAAHNASVAPGKTAAAWAGTNLGFRSNHIGCSAPSQWSPVKDSVSVRQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.84
3 0.77
4 0.68
5 0.6
6 0.49
7 0.39
8 0.33
9 0.3
10 0.27
11 0.27
12 0.28
13 0.26
14 0.26
15 0.25
16 0.22
17 0.19
18 0.16
19 0.16
20 0.15
21 0.15
22 0.15
23 0.15
24 0.13
25 0.13
26 0.1
27 0.07
28 0.06
29 0.07
30 0.07
31 0.07
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.05
40 0.07
41 0.08
42 0.08
43 0.08
44 0.11
45 0.1
46 0.11
47 0.18
48 0.16
49 0.17
50 0.17
51 0.19
52 0.16
53 0.23
54 0.24
55 0.2
56 0.2
57 0.23
58 0.26
59 0.27
60 0.32
61 0.29
62 0.3
63 0.3
64 0.34