Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GXF6

Protein Details
Accession Q2GXF6    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
103-125SEDDRDRRRRSRRTRSPSGQSTRBasic
NLS Segment(s)
PositionSequence
109-116RRRRSRRT
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MTSSLPPDPWKALGIERNADKSEIRTAYKKLVLKCHPDKIQDPTLKALKADDTPPTAPESPPRVSRSHTAPHAVYGTIPSLSRTQTWAPSSNPAPAYYDDIESEDDRDRRRRSRRTRSPSGQSTRYKVDGVKTSKMDPQYSYGESPSSTRRYAADGYIEHLAHSPSSATYSGAQFRVKQTKSYTPDDIMFAHYDQPSYYGPHGGDAYTAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.37
4 0.4
5 0.39
6 0.39
7 0.33
8 0.3
9 0.34
10 0.31
11 0.32
12 0.32
13 0.34
14 0.39
15 0.45
16 0.47
17 0.44
18 0.5
19 0.52
20 0.58
21 0.62
22 0.65
23 0.63
24 0.64
25 0.63
26 0.6
27 0.63
28 0.58
29 0.52
30 0.49
31 0.49
32 0.44
33 0.4
34 0.34
35 0.27
36 0.25
37 0.25
38 0.22
39 0.22
40 0.22
41 0.23
42 0.26
43 0.25
44 0.22
45 0.26
46 0.29
47 0.28
48 0.33
49 0.35
50 0.32
51 0.34
52 0.38
53 0.37
54 0.39
55 0.38
56 0.37
57 0.33
58 0.33
59 0.32
60 0.27
61 0.22
62 0.16
63 0.14
64 0.1
65 0.1
66 0.09
67 0.1
68 0.11
69 0.11
70 0.13
71 0.14
72 0.18
73 0.2
74 0.22
75 0.22
76 0.25
77 0.26
78 0.27
79 0.26
80 0.22
81 0.22
82 0.19
83 0.22
84 0.19
85 0.18
86 0.14
87 0.14
88 0.15
89 0.13
90 0.14
91 0.13
92 0.14
93 0.16
94 0.22
95 0.26
96 0.33
97 0.42
98 0.51
99 0.59
100 0.68
101 0.77
102 0.8
103 0.86
104 0.85
105 0.84
106 0.83
107 0.79
108 0.76
109 0.68
110 0.63
111 0.56
112 0.5
113 0.42
114 0.34
115 0.32
116 0.32
117 0.33
118 0.34
119 0.32
120 0.33
121 0.35
122 0.37
123 0.34
124 0.27
125 0.27
126 0.26
127 0.26
128 0.25
129 0.22
130 0.2
131 0.19
132 0.2
133 0.21
134 0.21
135 0.19
136 0.19
137 0.19
138 0.23
139 0.24
140 0.23
141 0.22
142 0.19
143 0.21
144 0.23
145 0.22
146 0.19
147 0.18
148 0.17
149 0.12
150 0.12
151 0.1
152 0.07
153 0.09
154 0.09
155 0.1
156 0.12
157 0.15
158 0.18
159 0.21
160 0.22
161 0.22
162 0.29
163 0.38
164 0.37
165 0.39
166 0.42
167 0.48
168 0.53
169 0.56
170 0.54
171 0.47
172 0.48
173 0.45
174 0.4
175 0.33
176 0.29
177 0.24
178 0.24
179 0.21
180 0.2
181 0.18
182 0.2
183 0.18
184 0.2
185 0.21
186 0.2
187 0.19
188 0.22
189 0.23
190 0.2
191 0.21