Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XTP5

Protein Details
Accession G1XTP5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-67ILPPKKRTPAGPPPKKKPRVKLAQNLSLTHydrophilic
NLS Segment(s)
PositionSequence
41-59PPKKRTPAGPPPKKKPRVK
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR002048  EF_hand_dom  
Gene Ontology GO:0005509  F:calcium ion binding  
PROSITE View protein in PROSITE  
PS50222  EF_HAND_2  
Amino Acid Sequences MRCCCIAGHTAPKLHMDTPSNSPSKFTQDNLRNYGRPFILPPKKRTPAGPPPKKKPRVKLAQNLSLTAEEEKEVRAAFGYFTDPEELGNDVILSKNLKKVFSALGFSLSTGEVRDILKSIDPDDEGFITYELFLEVAAMKIKDRDKKEEVEKAFSLFTGGDDEGPITLQHLRKVAKVLNENVSDDTLREMLREASASGGMDVDKRDFEDVMRRAGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.32
4 0.31
5 0.35
6 0.41
7 0.41
8 0.38
9 0.39
10 0.36
11 0.39
12 0.38
13 0.34
14 0.37
15 0.42
16 0.5
17 0.54
18 0.57
19 0.53
20 0.51
21 0.55
22 0.46
23 0.38
24 0.35
25 0.39
26 0.44
27 0.48
28 0.54
29 0.58
30 0.63
31 0.63
32 0.63
33 0.62
34 0.63
35 0.67
36 0.7
37 0.7
38 0.74
39 0.84
40 0.9
41 0.88
42 0.86
43 0.85
44 0.85
45 0.85
46 0.84
47 0.82
48 0.81
49 0.74
50 0.65
51 0.56
52 0.46
53 0.37
54 0.28
55 0.2
56 0.11
57 0.1
58 0.09
59 0.09
60 0.08
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.08
67 0.08
68 0.09
69 0.1
70 0.09
71 0.09
72 0.1
73 0.1
74 0.08
75 0.07
76 0.06
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.12
83 0.14
84 0.14
85 0.14
86 0.15
87 0.18
88 0.17
89 0.19
90 0.14
91 0.15
92 0.14
93 0.14
94 0.13
95 0.1
96 0.09
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.06
104 0.08
105 0.08
106 0.09
107 0.08
108 0.09
109 0.09
110 0.09
111 0.09
112 0.08
113 0.08
114 0.07
115 0.06
116 0.06
117 0.06
118 0.05
119 0.04
120 0.03
121 0.03
122 0.03
123 0.04
124 0.05
125 0.05
126 0.06
127 0.1
128 0.15
129 0.22
130 0.25
131 0.32
132 0.35
133 0.41
134 0.48
135 0.52
136 0.5
137 0.49
138 0.46
139 0.4
140 0.37
141 0.3
142 0.24
143 0.16
144 0.14
145 0.11
146 0.1
147 0.09
148 0.09
149 0.09
150 0.08
151 0.09
152 0.08
153 0.06
154 0.11
155 0.12
156 0.15
157 0.2
158 0.21
159 0.22
160 0.27
161 0.29
162 0.32
163 0.36
164 0.39
165 0.41
166 0.42
167 0.41
168 0.38
169 0.37
170 0.29
171 0.24
172 0.21
173 0.16
174 0.14
175 0.12
176 0.12
177 0.12
178 0.13
179 0.13
180 0.11
181 0.11
182 0.12
183 0.12
184 0.11
185 0.1
186 0.09
187 0.1
188 0.12
189 0.12
190 0.12
191 0.13
192 0.15
193 0.14
194 0.16
195 0.24
196 0.25
197 0.28