Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XRL0

Protein Details
Accession G1XRL0    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-97GVPSLPKSEKKSKKEKKDKKSKKSKKERSGSSSSGBasic
NLS Segment(s)
PositionSequence
68-90PKSEKKSKKEKKDKKSKKSKKER
Subcellular Location(s) nucl 15.5, cyto_nucl 10, mito 8
Family & Domain DBs
Amino Acid Sequences MSAQYHSGSQDGVKTYIDRNGDTVQESSGPTPIFRGLAAAGGEAFISDSEESSGEEYHQHAHGVPSLPKSEKKSKKEKKDKKSKKSKKERSGSSSSGHGCNCSHSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.23
4 0.24
5 0.2
6 0.21
7 0.22
8 0.22
9 0.22
10 0.21
11 0.17
12 0.16
13 0.17
14 0.14
15 0.15
16 0.14
17 0.12
18 0.12
19 0.12
20 0.11
21 0.1
22 0.1
23 0.07
24 0.09
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.05
31 0.05
32 0.03
33 0.04
34 0.04
35 0.04
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.05
42 0.06
43 0.07
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.11
50 0.13
51 0.15
52 0.15
53 0.18
54 0.2
55 0.23
56 0.3
57 0.38
58 0.44
59 0.5
60 0.6
61 0.67
62 0.76
63 0.84
64 0.88
65 0.88
66 0.9
67 0.94
68 0.94
69 0.95
70 0.95
71 0.94
72 0.95
73 0.95
74 0.95
75 0.94
76 0.92
77 0.89
78 0.86
79 0.79
80 0.7
81 0.67
82 0.59
83 0.54
84 0.45
85 0.39
86 0.31