Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1WY19

Protein Details
Accession G1WY19    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
100-124TWCPYNSCPKKMKKRAPKPIPEPAPHydrophilic
141-164GWCPYNSCPKNKKREPQPIPEPIPHydrophilic
180-207AEPTWCPYNSCPKNKKRQPEPVPEPVEAHydrophilic
NLS Segment(s)
PositionSequence
109-130KKMKKRAPKPIPEPAPAPEAAP
Subcellular Location(s) extr 13, E.R. 6, mito 2, golg 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MQIKSIILFSALAAPILALPAANPEALALAAAEAAPNHKWCPFNSCPHKKREAEPAPAPKPKPTWCPYNSCPKKVKREAEPEPAPIPEPAPEPVAEPEPTWCPYNSCPKKMKKRAPKPIPEPAPAPEAAPEPKAAPKASPGWCPYNSCPKNKKREPQPIPEPIPEPIAAPEPEPVAAPEAEPTWCPYNSCPKNKKRQPEPVPEPVEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.04
6 0.04
7 0.07
8 0.08
9 0.08
10 0.08
11 0.07
12 0.08
13 0.08
14 0.08
15 0.05
16 0.04
17 0.04
18 0.04
19 0.04
20 0.04
21 0.06
22 0.08
23 0.09
24 0.11
25 0.15
26 0.17
27 0.18
28 0.26
29 0.3
30 0.39
31 0.48
32 0.58
33 0.6
34 0.65
35 0.74
36 0.69
37 0.68
38 0.68
39 0.65
40 0.62
41 0.65
42 0.67
43 0.65
44 0.68
45 0.65
46 0.58
47 0.56
48 0.52
49 0.53
50 0.47
51 0.49
52 0.46
53 0.53
54 0.52
55 0.58
56 0.6
57 0.58
58 0.62
59 0.61
60 0.68
61 0.68
62 0.72
63 0.69
64 0.72
65 0.72
66 0.73
67 0.68
68 0.61
69 0.53
70 0.46
71 0.39
72 0.29
73 0.23
74 0.14
75 0.13
76 0.11
77 0.11
78 0.11
79 0.11
80 0.12
81 0.14
82 0.13
83 0.11
84 0.12
85 0.13
86 0.15
87 0.14
88 0.13
89 0.13
90 0.16
91 0.27
92 0.3
93 0.34
94 0.4
95 0.48
96 0.59
97 0.67
98 0.75
99 0.75
100 0.81
101 0.86
102 0.88
103 0.89
104 0.84
105 0.84
106 0.79
107 0.71
108 0.62
109 0.52
110 0.45
111 0.36
112 0.29
113 0.2
114 0.17
115 0.16
116 0.15
117 0.13
118 0.12
119 0.14
120 0.16
121 0.15
122 0.14
123 0.16
124 0.22
125 0.25
126 0.29
127 0.3
128 0.33
129 0.34
130 0.39
131 0.4
132 0.44
133 0.45
134 0.49
135 0.55
136 0.59
137 0.68
138 0.72
139 0.78
140 0.77
141 0.84
142 0.82
143 0.83
144 0.83
145 0.82
146 0.78
147 0.72
148 0.64
149 0.54
150 0.49
151 0.39
152 0.3
153 0.22
154 0.21
155 0.18
156 0.16
157 0.16
158 0.15
159 0.15
160 0.14
161 0.13
162 0.12
163 0.11
164 0.11
165 0.11
166 0.11
167 0.12
168 0.12
169 0.16
170 0.17
171 0.18
172 0.19
173 0.22
174 0.32
175 0.41
176 0.51
177 0.57
178 0.62
179 0.73
180 0.8
181 0.87
182 0.87
183 0.89
184 0.88
185 0.9
186 0.88
187 0.87