Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XHX4

Protein Details
Accession G1XHX4    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
127-153IFDKQVENLKRNKPRRRQSERVHESAEHydrophilic
NLS Segment(s)
PositionSequence
140-141PR
Subcellular Location(s) nucl 15, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MSTSQHVSAAPPRVPAPERGPGEKLTDRKVRHAFEDPYWDWELYGFKAVLKQHKRRCKNILLQLTESSLPVPPLIGKFAELGEKVQGQVLDWLVADIKLSQPKLRDIMLAMILATSTDGNNWFVAYIFDKQVENLKRNKPRRRQSERVHESAETNTTESHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.36
4 0.38
5 0.41
6 0.42
7 0.44
8 0.4
9 0.45
10 0.46
11 0.44
12 0.43
13 0.46
14 0.44
15 0.51
16 0.56
17 0.51
18 0.5
19 0.54
20 0.51
21 0.46
22 0.53
23 0.45
24 0.42
25 0.42
26 0.36
27 0.28
28 0.26
29 0.24
30 0.16
31 0.17
32 0.12
33 0.1
34 0.14
35 0.18
36 0.26
37 0.34
38 0.42
39 0.5
40 0.6
41 0.67
42 0.7
43 0.75
44 0.74
45 0.74
46 0.74
47 0.73
48 0.67
49 0.62
50 0.55
51 0.49
52 0.4
53 0.31
54 0.22
55 0.14
56 0.1
57 0.08
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.08
68 0.08
69 0.09
70 0.09
71 0.08
72 0.09
73 0.08
74 0.07
75 0.08
76 0.08
77 0.07
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.04
84 0.06
85 0.09
86 0.1
87 0.12
88 0.14
89 0.16
90 0.18
91 0.19
92 0.17
93 0.15
94 0.16
95 0.15
96 0.14
97 0.11
98 0.09
99 0.08
100 0.07
101 0.07
102 0.05
103 0.04
104 0.04
105 0.06
106 0.07
107 0.07
108 0.08
109 0.07
110 0.07
111 0.09
112 0.11
113 0.12
114 0.12
115 0.14
116 0.14
117 0.15
118 0.23
119 0.27
120 0.3
121 0.35
122 0.44
123 0.53
124 0.63
125 0.73
126 0.75
127 0.8
128 0.87
129 0.89
130 0.89
131 0.9
132 0.91
133 0.89
134 0.84
135 0.78
136 0.68
137 0.6
138 0.53
139 0.46
140 0.37
141 0.3