Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XKY8

Protein Details
Accession G1XKY8   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MSSPSEPLKKRPRTQSCPPPLPTTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029028  Alpha/beta_knot_MTases  
IPR005304  Rbsml_bgen_MeTrfase_EMG1/NEP1  
IPR029026  tRNA_m1G_MTases_N  
Gene Ontology GO:0070037  F:rRNA (pseudouridine) methyltransferase activity  
GO:0019843  F:rRNA binding  
GO:0070475  P:rRNA base methylation  
Pfam View protein in Pfam  
PF03587  EMG1  
CDD cd18088  Nep1-like  
Amino Acid Sequences MSSPSEPLKKRPRTQSCPPPLPTTVATAATPIPTSDKSTKRLIVVLAQACLETHKVTTGSGPSAGEKYVLLNSDDHIGVLKKMNRDISDARPDILHQCLLTLLDSPVNKAGKLQVYVQSTKGVLIEVNPTVRIPRTFKRFAGLMVQLLHKLSIRSTTSPEKLLKVIKNPVSQYLPPNCRKITLSWDAPVRNMREYVDALGEDESLCVVVGAMAKGKDDFADEWVDEKIGVSNYSLSASVACSKVCHSVEDCWGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.88
4 0.86
5 0.82
6 0.77
7 0.68
8 0.64
9 0.55
10 0.49
11 0.41
12 0.33
13 0.29
14 0.24
15 0.23
16 0.19
17 0.18
18 0.13
19 0.14
20 0.14
21 0.21
22 0.27
23 0.32
24 0.35
25 0.41
26 0.43
27 0.41
28 0.42
29 0.37
30 0.34
31 0.36
32 0.34
33 0.29
34 0.25
35 0.23
36 0.21
37 0.21
38 0.17
39 0.1
40 0.09
41 0.1
42 0.1
43 0.11
44 0.13
45 0.14
46 0.14
47 0.15
48 0.15
49 0.14
50 0.15
51 0.15
52 0.13
53 0.1
54 0.11
55 0.11
56 0.12
57 0.11
58 0.11
59 0.11
60 0.13
61 0.13
62 0.11
63 0.11
64 0.1
65 0.1
66 0.15
67 0.18
68 0.17
69 0.21
70 0.24
71 0.24
72 0.28
73 0.31
74 0.32
75 0.37
76 0.36
77 0.33
78 0.3
79 0.3
80 0.27
81 0.25
82 0.19
83 0.1
84 0.1
85 0.1
86 0.1
87 0.09
88 0.08
89 0.07
90 0.09
91 0.09
92 0.1
93 0.14
94 0.14
95 0.14
96 0.13
97 0.16
98 0.15
99 0.17
100 0.18
101 0.19
102 0.22
103 0.23
104 0.24
105 0.22
106 0.19
107 0.18
108 0.16
109 0.11
110 0.07
111 0.07
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.11
120 0.14
121 0.19
122 0.26
123 0.29
124 0.29
125 0.31
126 0.31
127 0.29
128 0.3
129 0.25
130 0.19
131 0.18
132 0.18
133 0.16
134 0.15
135 0.15
136 0.1
137 0.09
138 0.08
139 0.11
140 0.13
141 0.14
142 0.19
143 0.24
144 0.25
145 0.3
146 0.31
147 0.28
148 0.28
149 0.33
150 0.32
151 0.31
152 0.37
153 0.38
154 0.42
155 0.41
156 0.42
157 0.41
158 0.4
159 0.41
160 0.42
161 0.45
162 0.45
163 0.49
164 0.45
165 0.43
166 0.43
167 0.38
168 0.37
169 0.36
170 0.35
171 0.33
172 0.38
173 0.36
174 0.37
175 0.4
176 0.34
177 0.29
178 0.27
179 0.24
180 0.22
181 0.23
182 0.22
183 0.18
184 0.16
185 0.14
186 0.14
187 0.13
188 0.1
189 0.08
190 0.07
191 0.05
192 0.05
193 0.04
194 0.03
195 0.04
196 0.05
197 0.06
198 0.08
199 0.09
200 0.09
201 0.1
202 0.1
203 0.1
204 0.11
205 0.12
206 0.12
207 0.15
208 0.14
209 0.16
210 0.16
211 0.16
212 0.13
213 0.13
214 0.13
215 0.11
216 0.12
217 0.11
218 0.12
219 0.12
220 0.14
221 0.14
222 0.11
223 0.1
224 0.12
225 0.15
226 0.15
227 0.15
228 0.14
229 0.16
230 0.24
231 0.24
232 0.26
233 0.25
234 0.28
235 0.34