Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1X638

Protein Details
Accession G1X638   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
328-348GTATPPKVDKHKKREDVEGANHydrophilic
NLS Segment(s)
PositionSequence
226-242ASVKRGHAKNPHRRKVK
Subcellular Location(s) cyto_nucl 13.5, nucl 13, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR014752  Arrestin-like_C  
IPR014756  Ig_E-set  
Amino Acid Sequences MFIALAAEFIDDDHPPPSTILRQGENSGPFWSIRKGEGAFPFDVNLPLDVGPGTFDSGTARIRYVIYGTILFKIGDKKFLVRCCRDVAVAPSLGEFRKTVTDFDREVKVFEERNFVPEGSLKLTANLSRPYWFSGGSAFVDVLVENETQFRIKTIRVRLVRRIDVYPKDPKDHPTPATLTKTMARSELNAGSRWTGLTFNKQDAVTCEIDIPKGQLTIPLGKLKLASVKRGHAKNPHRRKVKAVLPIRVLHKDSIHEALMSGIGNKPSFASFSAMRRSLPFAPQRLSTSTSTNGTVVRRRYTDSDLSQVEPIPITEAGHQPTNHVTSGTATPPKVDKHKKREDVEGANPDDSQASSSRHFYSFTSHIPSVRSYFSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.16
5 0.19
6 0.25
7 0.28
8 0.31
9 0.33
10 0.35
11 0.41
12 0.4
13 0.37
14 0.32
15 0.29
16 0.26
17 0.26
18 0.27
19 0.23
20 0.21
21 0.25
22 0.25
23 0.3
24 0.35
25 0.37
26 0.34
27 0.33
28 0.32
29 0.28
30 0.28
31 0.23
32 0.17
33 0.14
34 0.12
35 0.12
36 0.1
37 0.09
38 0.09
39 0.08
40 0.1
41 0.08
42 0.08
43 0.1
44 0.12
45 0.15
46 0.14
47 0.14
48 0.14
49 0.15
50 0.16
51 0.15
52 0.15
53 0.14
54 0.16
55 0.17
56 0.16
57 0.17
58 0.16
59 0.17
60 0.23
61 0.22
62 0.24
63 0.24
64 0.28
65 0.33
66 0.41
67 0.48
68 0.45
69 0.48
70 0.47
71 0.47
72 0.43
73 0.4
74 0.36
75 0.32
76 0.28
77 0.25
78 0.21
79 0.21
80 0.2
81 0.18
82 0.14
83 0.11
84 0.16
85 0.17
86 0.18
87 0.2
88 0.25
89 0.26
90 0.29
91 0.33
92 0.28
93 0.28
94 0.27
95 0.27
96 0.26
97 0.25
98 0.28
99 0.22
100 0.24
101 0.25
102 0.24
103 0.21
104 0.19
105 0.2
106 0.16
107 0.18
108 0.16
109 0.15
110 0.17
111 0.18
112 0.2
113 0.21
114 0.19
115 0.18
116 0.19
117 0.21
118 0.2
119 0.18
120 0.15
121 0.13
122 0.14
123 0.13
124 0.13
125 0.1
126 0.08
127 0.08
128 0.08
129 0.07
130 0.06
131 0.06
132 0.05
133 0.06
134 0.07
135 0.07
136 0.07
137 0.08
138 0.08
139 0.1
140 0.17
141 0.22
142 0.3
143 0.36
144 0.41
145 0.48
146 0.53
147 0.54
148 0.51
149 0.48
150 0.46
151 0.43
152 0.44
153 0.44
154 0.4
155 0.4
156 0.39
157 0.4
158 0.4
159 0.42
160 0.39
161 0.34
162 0.34
163 0.35
164 0.38
165 0.34
166 0.29
167 0.26
168 0.27
169 0.23
170 0.22
171 0.17
172 0.15
173 0.17
174 0.2
175 0.18
176 0.17
177 0.17
178 0.16
179 0.16
180 0.14
181 0.12
182 0.11
183 0.1
184 0.16
185 0.17
186 0.18
187 0.2
188 0.2
189 0.2
190 0.2
191 0.23
192 0.17
193 0.16
194 0.16
195 0.14
196 0.14
197 0.14
198 0.12
199 0.08
200 0.08
201 0.08
202 0.08
203 0.1
204 0.13
205 0.15
206 0.18
207 0.17
208 0.17
209 0.18
210 0.16
211 0.22
212 0.2
213 0.24
214 0.23
215 0.29
216 0.36
217 0.39
218 0.43
219 0.45
220 0.55
221 0.59
222 0.68
223 0.71
224 0.72
225 0.71
226 0.73
227 0.72
228 0.68
229 0.67
230 0.63
231 0.6
232 0.56
233 0.59
234 0.56
235 0.51
236 0.46
237 0.38
238 0.32
239 0.27
240 0.26
241 0.24
242 0.21
243 0.17
244 0.15
245 0.13
246 0.13
247 0.11
248 0.09
249 0.08
250 0.1
251 0.1
252 0.1
253 0.1
254 0.09
255 0.11
256 0.11
257 0.13
258 0.14
259 0.19
260 0.25
261 0.26
262 0.26
263 0.26
264 0.3
265 0.29
266 0.34
267 0.35
268 0.33
269 0.35
270 0.37
271 0.39
272 0.37
273 0.39
274 0.33
275 0.31
276 0.29
277 0.29
278 0.27
279 0.25
280 0.25
281 0.25
282 0.29
283 0.3
284 0.32
285 0.32
286 0.34
287 0.37
288 0.4
289 0.44
290 0.4
291 0.43
292 0.4
293 0.4
294 0.38
295 0.34
296 0.29
297 0.22
298 0.19
299 0.14
300 0.13
301 0.12
302 0.14
303 0.17
304 0.19
305 0.24
306 0.23
307 0.23
308 0.27
309 0.28
310 0.26
311 0.22
312 0.2
313 0.18
314 0.22
315 0.25
316 0.26
317 0.23
318 0.25
319 0.29
320 0.34
321 0.42
322 0.5
323 0.55
324 0.61
325 0.72
326 0.78
327 0.79
328 0.83
329 0.81
330 0.79
331 0.77
332 0.75
333 0.67
334 0.59
335 0.54
336 0.45
337 0.36
338 0.28
339 0.22
340 0.17
341 0.17
342 0.19
343 0.23
344 0.26
345 0.26
346 0.27
347 0.26
348 0.3
349 0.31
350 0.33
351 0.37
352 0.35
353 0.36
354 0.37
355 0.4
356 0.37
357 0.37