Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1X4D5

Protein Details
Accession G1X4D5   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-34MRKREKKERKEKMKMKKEKMKGNRMRRIKGRNGEBasic
NLS Segment(s)
PositionSequence
2-32RKREKKERKEKMKMKKEKMKGNRMRRIKGRN
Subcellular Location(s) nucl 23, mito 3
Family & Domain DBs
Amino Acid Sequences MRKREKKERKEKMKMKKEKMKGNRMRRIKGRNGEERGGFTVSGSEEFDLENDSDVGGGIGGSEGERPRVRGDSDGNEVDENGDYVDEELRARSTDWNGWYI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.92
3 0.91
4 0.89
5 0.88
6 0.89
7 0.89
8 0.88
9 0.88
10 0.87
11 0.86
12 0.85
13 0.83
14 0.82
15 0.8
16 0.79
17 0.76
18 0.76
19 0.73
20 0.68
21 0.6
22 0.54
23 0.47
24 0.38
25 0.3
26 0.2
27 0.16
28 0.12
29 0.12
30 0.1
31 0.07
32 0.06
33 0.06
34 0.07
35 0.06
36 0.06
37 0.06
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.04
50 0.05
51 0.09
52 0.09
53 0.11
54 0.13
55 0.15
56 0.17
57 0.19
58 0.23
59 0.24
60 0.29
61 0.29
62 0.28
63 0.26
64 0.25
65 0.22
66 0.18
67 0.13
68 0.08
69 0.07
70 0.06
71 0.06
72 0.07
73 0.07
74 0.07
75 0.08
76 0.09
77 0.1
78 0.11
79 0.15
80 0.18
81 0.24