Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XRH2

Protein Details
Accession G1XRH2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
31-54DERYMVKTKPKGRKKRSGRQVYEVBasic
NLS Segment(s)
PositionSequence
38-48TKPKGRKKRSG
Subcellular Location(s) cyto_nucl 10.5, nucl 10, cysk 10, cyto 7
Family & Domain DBs
Amino Acid Sequences MFIVGIDGRVIEEGDEHDLGIPNQDDYELLDERYMVKTKPKGRKKRSGRQVYEVVGIAFGEVVGLIREELSRSQGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.1
5 0.11
6 0.11
7 0.13
8 0.12
9 0.09
10 0.09
11 0.09
12 0.08
13 0.08
14 0.11
15 0.09
16 0.09
17 0.09
18 0.09
19 0.1
20 0.13
21 0.13
22 0.1
23 0.14
24 0.21
25 0.29
26 0.4
27 0.49
28 0.57
29 0.65
30 0.76
31 0.81
32 0.85
33 0.87
34 0.88
35 0.83
36 0.79
37 0.76
38 0.68
39 0.6
40 0.5
41 0.39
42 0.28
43 0.22
44 0.15
45 0.09
46 0.06
47 0.04
48 0.03
49 0.03
50 0.03
51 0.04
52 0.04
53 0.05
54 0.05
55 0.07
56 0.09