Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XR60

Protein Details
Accession G1XR60    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-23SVTVRTRKFLRNPLLQRKQMHydrophilic
95-125EYATKIEKASRQQRKQRKNRMKEVRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
102-134KASRQQRKQRKNRMKEVRGTAKTKAASKDKKKK
Subcellular Location(s) mito 18, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSVTVRTRKFLRNPLLQRKQMVVDILHPGLPNISKSDLREKLGKLYKADAGTVSVFGLRTQYGGGKTTGFALIYDSLDALKKFEPHYRLVRYEYATKIEKASRQQRKQRKNRMKEVRGTAKTKAASKDKKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.72
3 0.78
4 0.82
5 0.78
6 0.73
7 0.66
8 0.6
9 0.52
10 0.44
11 0.34
12 0.27
13 0.27
14 0.25
15 0.23
16 0.2
17 0.17
18 0.16
19 0.16
20 0.14
21 0.12
22 0.15
23 0.15
24 0.18
25 0.27
26 0.29
27 0.31
28 0.35
29 0.34
30 0.4
31 0.45
32 0.45
33 0.37
34 0.36
35 0.37
36 0.33
37 0.32
38 0.23
39 0.18
40 0.15
41 0.14
42 0.11
43 0.08
44 0.07
45 0.07
46 0.07
47 0.05
48 0.05
49 0.05
50 0.07
51 0.08
52 0.09
53 0.09
54 0.09
55 0.09
56 0.1
57 0.1
58 0.08
59 0.07
60 0.07
61 0.08
62 0.07
63 0.07
64 0.06
65 0.06
66 0.08
67 0.08
68 0.08
69 0.08
70 0.1
71 0.12
72 0.17
73 0.2
74 0.24
75 0.31
76 0.35
77 0.37
78 0.39
79 0.4
80 0.38
81 0.4
82 0.37
83 0.35
84 0.33
85 0.31
86 0.3
87 0.3
88 0.32
89 0.36
90 0.45
91 0.51
92 0.58
93 0.67
94 0.75
95 0.82
96 0.89
97 0.91
98 0.92
99 0.91
100 0.92
101 0.93
102 0.91
103 0.89
104 0.89
105 0.88
106 0.84
107 0.78
108 0.71
109 0.66
110 0.62
111 0.59
112 0.57
113 0.57
114 0.6