Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1X688

Protein Details
Accession G1X688    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
159-179WIVNRRRNRAAEKRREEERRVBasic
NLS Segment(s)
PositionSequence
163-178RRRNRAAEKRREEERR
Subcellular Location(s) mito 12, cyto 7, plas 3, extr 2, nucl 1, pero 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR018466  Kre9/Knh1-like_N  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF10342  Kre9_KNH  
Amino Acid Sequences MEMPTFTTFQGNKVTSPNPSTTLTVGKPFLITWTNITGPPTTPQVTIYLLNSLNPAAKRPSDLSRARRIATVENTGSYRWMVPGSLADKETYVIEMSYDSWMGNYSYSQPFAIMGAGANPPTLPDYDTNVGLNWENSKAAVAAILAGVGLLVAAGTGYWIVNRRRNRAAEKRREEERRVREVKLGEVEMGGVSGRTSVDGTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.36
4 0.36
5 0.31
6 0.33
7 0.33
8 0.3
9 0.33
10 0.3
11 0.3
12 0.28
13 0.25
14 0.23
15 0.21
16 0.22
17 0.19
18 0.18
19 0.16
20 0.2
21 0.2
22 0.21
23 0.23
24 0.2
25 0.19
26 0.21
27 0.22
28 0.2
29 0.19
30 0.18
31 0.19
32 0.2
33 0.2
34 0.18
35 0.18
36 0.16
37 0.16
38 0.16
39 0.14
40 0.16
41 0.14
42 0.16
43 0.15
44 0.15
45 0.18
46 0.21
47 0.25
48 0.3
49 0.38
50 0.42
51 0.49
52 0.51
53 0.49
54 0.48
55 0.45
56 0.42
57 0.38
58 0.37
59 0.28
60 0.26
61 0.26
62 0.24
63 0.22
64 0.17
65 0.14
66 0.09
67 0.08
68 0.07
69 0.06
70 0.09
71 0.1
72 0.11
73 0.12
74 0.11
75 0.11
76 0.11
77 0.11
78 0.09
79 0.07
80 0.05
81 0.05
82 0.05
83 0.06
84 0.06
85 0.06
86 0.05
87 0.05
88 0.06
89 0.06
90 0.06
91 0.05
92 0.08
93 0.09
94 0.1
95 0.1
96 0.09
97 0.09
98 0.09
99 0.09
100 0.05
101 0.04
102 0.05
103 0.05
104 0.05
105 0.05
106 0.05
107 0.05
108 0.06
109 0.06
110 0.06
111 0.07
112 0.12
113 0.13
114 0.14
115 0.15
116 0.14
117 0.15
118 0.14
119 0.13
120 0.1
121 0.09
122 0.09
123 0.08
124 0.09
125 0.08
126 0.07
127 0.07
128 0.05
129 0.04
130 0.04
131 0.04
132 0.03
133 0.03
134 0.03
135 0.02
136 0.02
137 0.01
138 0.01
139 0.01
140 0.01
141 0.01
142 0.02
143 0.02
144 0.02
145 0.04
146 0.1
147 0.15
148 0.23
149 0.3
150 0.36
151 0.43
152 0.5
153 0.59
154 0.65
155 0.71
156 0.75
157 0.78
158 0.78
159 0.8
160 0.82
161 0.8
162 0.79
163 0.76
164 0.76
165 0.71
166 0.67
167 0.63
168 0.57
169 0.55
170 0.5
171 0.43
172 0.33
173 0.28
174 0.27
175 0.21
176 0.19
177 0.12
178 0.07
179 0.05
180 0.06
181 0.06
182 0.06