Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1X0P2

Protein Details
Accession G1X0P2   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-94YRDRTKGGRYPKPYDGRKKGBasic
NLS Segment(s)
PositionSequence
91-93RKK
Subcellular Location(s) nucl 11, cyto 9, pero 3, vacu 2
Family & Domain DBs
Amino Acid Sequences MFSNRPIQTNDIDSAPPLDEVGPRRVQRPLPPGHVRTSRIYHDYTDPTEPEIDEFGFQNWFGPGDNDFGYPEPQYRDRTKGGRYPKPYDGRKKGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.16
4 0.12
5 0.11
6 0.12
7 0.16
8 0.21
9 0.26
10 0.26
11 0.28
12 0.32
13 0.35
14 0.38
15 0.43
16 0.43
17 0.45
18 0.51
19 0.52
20 0.54
21 0.56
22 0.52
23 0.48
24 0.46
25 0.4
26 0.37
27 0.35
28 0.3
29 0.28
30 0.28
31 0.26
32 0.24
33 0.21
34 0.19
35 0.18
36 0.16
37 0.13
38 0.11
39 0.09
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.06
47 0.07
48 0.06
49 0.07
50 0.07
51 0.09
52 0.1
53 0.1
54 0.11
55 0.12
56 0.13
57 0.13
58 0.14
59 0.17
60 0.2
61 0.25
62 0.29
63 0.33
64 0.37
65 0.42
66 0.46
67 0.49
68 0.56
69 0.6
70 0.63
71 0.65
72 0.69
73 0.73
74 0.77
75 0.8
76 0.8