Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1WYP2

Protein Details
Accession G1WYP2    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
77-102KETDEKPKAKRGKKRKIEETTSKYENBasic
NLS Segment(s)
PositionSequence
51-66LRKKLQEKKDEKEAKA
72-92QVKKVKETDEKPKAKRGKKRK
Subcellular Location(s) nucl 25.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MVSNSNSVSDQEFLLRCIEHVHGDLKINFDKVAKDLGYASAAVAANRMRNLRKKLQEKKDEKEAKADNTSSQVKKVKETDEKPKAKRGKKRKIEETTSKYENEDKKAEDGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.14
4 0.16
5 0.17
6 0.14
7 0.15
8 0.16
9 0.16
10 0.2
11 0.21
12 0.22
13 0.22
14 0.21
15 0.2
16 0.19
17 0.18
18 0.15
19 0.19
20 0.15
21 0.13
22 0.13
23 0.13
24 0.13
25 0.12
26 0.11
27 0.1
28 0.1
29 0.09
30 0.1
31 0.1
32 0.1
33 0.12
34 0.15
35 0.15
36 0.22
37 0.28
38 0.34
39 0.43
40 0.52
41 0.6
42 0.67
43 0.74
44 0.74
45 0.73
46 0.76
47 0.74
48 0.64
49 0.62
50 0.56
51 0.49
52 0.47
53 0.42
54 0.33
55 0.3
56 0.36
57 0.29
58 0.31
59 0.33
60 0.3
61 0.34
62 0.37
63 0.4
64 0.43
65 0.48
66 0.53
67 0.58
68 0.66
69 0.65
70 0.7
71 0.72
72 0.72
73 0.77
74 0.77
75 0.78
76 0.8
77 0.87
78 0.88
79 0.88
80 0.89
81 0.9
82 0.86
83 0.83
84 0.76
85 0.67
86 0.59
87 0.57
88 0.53
89 0.49
90 0.46
91 0.4