Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G1XUS2

Protein Details
Accession G1XUS2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-67IAKFGRPLKRKERKIMKRKFKLDQMBasic
NLS Segment(s)
PositionSequence
45-62KFGRPLKRKERKIMKRKF
Subcellular Location(s) extr 7, nucl 5.5, plas 5, cyto_nucl 4.5, mito 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTFELIIIGTSAAAFLSGMLATEAYKALEMIYLEHRARVNHEIAKFGRPLKRKERKIMKRKFKLDQMAAALSVNTLNSKNSRRSDHAHTHGSGSERRSAPRSNYSDVPQPAPPPLPNPKHGPFADQSHALYIYDGSSSPDKGLSPRDSAQKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.05
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.07
17 0.09
18 0.12
19 0.17
20 0.17
21 0.2
22 0.21
23 0.2
24 0.24
25 0.26
26 0.27
27 0.27
28 0.28
29 0.3
30 0.31
31 0.33
32 0.31
33 0.32
34 0.35
35 0.35
36 0.42
37 0.48
38 0.57
39 0.61
40 0.69
41 0.75
42 0.79
43 0.84
44 0.88
45 0.88
46 0.87
47 0.87
48 0.82
49 0.78
50 0.75
51 0.67
52 0.6
53 0.51
54 0.42
55 0.35
56 0.29
57 0.21
58 0.13
59 0.11
60 0.07
61 0.05
62 0.05
63 0.06
64 0.09
65 0.13
66 0.19
67 0.22
68 0.27
69 0.3
70 0.34
71 0.41
72 0.46
73 0.49
74 0.46
75 0.43
76 0.41
77 0.39
78 0.36
79 0.31
80 0.25
81 0.26
82 0.23
83 0.25
84 0.27
85 0.28
86 0.31
87 0.37
88 0.4
89 0.37
90 0.39
91 0.4
92 0.44
93 0.43
94 0.41
95 0.34
96 0.3
97 0.29
98 0.28
99 0.26
100 0.24
101 0.32
102 0.33
103 0.36
104 0.42
105 0.43
106 0.48
107 0.47
108 0.46
109 0.41
110 0.42
111 0.42
112 0.37
113 0.34
114 0.29
115 0.29
116 0.24
117 0.21
118 0.15
119 0.12
120 0.1
121 0.1
122 0.11
123 0.12
124 0.13
125 0.13
126 0.14
127 0.14
128 0.17
129 0.24
130 0.25
131 0.29
132 0.33
133 0.42