Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G1XTZ6

Protein Details
Accession G1XTZ6    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
84-114ILQQKSRHQNQPSRRHKQKNRRQRLQEVAIKHydrophilic
NLS Segment(s)
PositionSequence
97-105RRHKQKNRR
Subcellular Location(s) nucl 12, mito 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MFTSLRFLCFGNTPLPSLNSSRSPQRTPSLGSSSTSSLSPIEEELATPSTPESNDSGLTLSSSIGPYPIPSSLMREVESIRSHILQQKSRHQNQPSRRHKQKNRRQRLQEVAIKQSIASSIREKAKPIATPTCYYDVSSPYAEDTSVFELNPAGEKNTNEEEEFGIASQHDWDEMINPHYNYLGAQEQIWDGDLDSSAYWGLDDLISQGYFETYDNSSVVCHPKQDANTDESYSISKALTISRNVKQPNGDTGWWLVKHVDPRALSKLGSDCVIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.26
3 0.26
4 0.26
5 0.29
6 0.29
7 0.32
8 0.39
9 0.43
10 0.45
11 0.48
12 0.5
13 0.5
14 0.49
15 0.52
16 0.49
17 0.45
18 0.42
19 0.4
20 0.36
21 0.33
22 0.28
23 0.22
24 0.16
25 0.15
26 0.14
27 0.12
28 0.11
29 0.1
30 0.1
31 0.12
32 0.14
33 0.13
34 0.12
35 0.12
36 0.12
37 0.12
38 0.13
39 0.13
40 0.12
41 0.13
42 0.13
43 0.14
44 0.12
45 0.12
46 0.1
47 0.09
48 0.08
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.09
55 0.09
56 0.1
57 0.1
58 0.16
59 0.19
60 0.21
61 0.21
62 0.21
63 0.22
64 0.24
65 0.25
66 0.21
67 0.18
68 0.17
69 0.19
70 0.23
71 0.28
72 0.31
73 0.35
74 0.44
75 0.52
76 0.58
77 0.64
78 0.66
79 0.68
80 0.72
81 0.78
82 0.78
83 0.78
84 0.81
85 0.84
86 0.87
87 0.9
88 0.9
89 0.9
90 0.91
91 0.91
92 0.89
93 0.86
94 0.85
95 0.82
96 0.78
97 0.71
98 0.64
99 0.54
100 0.46
101 0.37
102 0.29
103 0.22
104 0.16
105 0.14
106 0.12
107 0.16
108 0.21
109 0.22
110 0.23
111 0.25
112 0.27
113 0.28
114 0.3
115 0.31
116 0.28
117 0.3
118 0.31
119 0.31
120 0.28
121 0.26
122 0.23
123 0.18
124 0.18
125 0.16
126 0.14
127 0.11
128 0.11
129 0.1
130 0.09
131 0.08
132 0.09
133 0.1
134 0.09
135 0.09
136 0.09
137 0.09
138 0.1
139 0.09
140 0.07
141 0.08
142 0.09
143 0.13
144 0.15
145 0.16
146 0.15
147 0.15
148 0.14
149 0.13
150 0.13
151 0.09
152 0.07
153 0.06
154 0.06
155 0.06
156 0.05
157 0.04
158 0.04
159 0.04
160 0.07
161 0.08
162 0.11
163 0.14
164 0.14
165 0.14
166 0.14
167 0.14
168 0.12
169 0.13
170 0.12
171 0.09
172 0.09
173 0.1
174 0.1
175 0.1
176 0.1
177 0.07
178 0.06
179 0.06
180 0.06
181 0.06
182 0.05
183 0.06
184 0.05
185 0.05
186 0.05
187 0.04
188 0.05
189 0.04
190 0.04
191 0.05
192 0.07
193 0.07
194 0.07
195 0.07
196 0.06
197 0.07
198 0.07
199 0.09
200 0.08
201 0.1
202 0.1
203 0.1
204 0.11
205 0.14
206 0.19
207 0.18
208 0.18
209 0.19
210 0.24
211 0.27
212 0.32
213 0.32
214 0.31
215 0.32
216 0.32
217 0.3
218 0.27
219 0.26
220 0.21
221 0.18
222 0.13
223 0.12
224 0.11
225 0.16
226 0.19
227 0.24
228 0.3
229 0.34
230 0.42
231 0.43
232 0.46
233 0.46
234 0.45
235 0.46
236 0.45
237 0.41
238 0.35
239 0.37
240 0.4
241 0.35
242 0.33
243 0.27
244 0.26
245 0.32
246 0.34
247 0.36
248 0.31
249 0.36
250 0.41
251 0.41
252 0.37
253 0.35
254 0.35
255 0.31