Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3JVR2

Protein Details
Accession E3JVR2    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MDRHLQQQHHRRRIKPFELPBasic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 7, cyto 4, plas 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR005351  ASTER  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0044183  F:protein folding chaperone  
GO:0045048  P:protein insertion into ER membrane  
KEGG pgr:PGTG_02578  -  
Pfam View protein in Pfam  
PF03669  ASTER  
Amino Acid Sequences MDRHLQQQHHRRRIKPFELPSQEYEEFDPSAVLALACAGVSMVLQQHILAWLSLFFSVTSIVNNTNRTGRPSSMSPLQGLMFSVLALTTLYTKRLIDPTLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.76
4 0.76
5 0.76
6 0.74
7 0.67
8 0.64
9 0.56
10 0.48
11 0.42
12 0.33
13 0.25
14 0.21
15 0.18
16 0.1
17 0.1
18 0.08
19 0.06
20 0.04
21 0.04
22 0.04
23 0.03
24 0.03
25 0.03
26 0.02
27 0.02
28 0.03
29 0.03
30 0.03
31 0.04
32 0.04
33 0.04
34 0.05
35 0.05
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.05
46 0.06
47 0.06
48 0.09
49 0.11
50 0.13
51 0.14
52 0.17
53 0.18
54 0.22
55 0.24
56 0.23
57 0.25
58 0.26
59 0.29
60 0.31
61 0.31
62 0.28
63 0.26
64 0.25
65 0.22
66 0.2
67 0.16
68 0.1
69 0.08
70 0.08
71 0.06
72 0.06
73 0.05
74 0.05
75 0.08
76 0.09
77 0.1
78 0.12
79 0.13
80 0.16
81 0.2