Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3L390

Protein Details
Accession E3L390   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-73IATSKKRVSKTSKSAKKKINPEIVPHydrophilic
NLS Segment(s)
PositionSequence
53-66KKRVSKTSKSAKKK
Subcellular Location(s) nucl 20, cyto_nucl 12, mito 4
Family & Domain DBs
KEGG pgr:PGTG_17287  -  
Amino Acid Sequences MPDQSPLTRPFIPSCVTPAVLTDLTTSAGKTAKPRQAPAAELISSVQPIATSKKRVSKTSKSAKKKINPEIVPSEWDTSTKEDTKSDRPEPTTSAAPMLKKSSTNSDPSSNKKPVDKLQDREHDPFKSKKPVNKLTNREVLNGIHIKKLSPADKPTAPPLAPSVPTNQAQSVTEETKIQLVDPVVHKTTNDSEKSTLIQPKESFFTPSFPPVDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.29
3 0.28
4 0.25
5 0.23
6 0.25
7 0.23
8 0.22
9 0.18
10 0.15
11 0.16
12 0.16
13 0.15
14 0.11
15 0.13
16 0.14
17 0.19
18 0.27
19 0.33
20 0.38
21 0.41
22 0.46
23 0.48
24 0.49
25 0.46
26 0.42
27 0.35
28 0.3
29 0.28
30 0.21
31 0.18
32 0.15
33 0.11
34 0.06
35 0.08
36 0.14
37 0.18
38 0.22
39 0.26
40 0.35
41 0.39
42 0.47
43 0.54
44 0.57
45 0.63
46 0.69
47 0.75
48 0.76
49 0.81
50 0.83
51 0.83
52 0.82
53 0.81
54 0.81
55 0.72
56 0.68
57 0.66
58 0.58
59 0.52
60 0.44
61 0.36
62 0.26
63 0.25
64 0.21
65 0.18
66 0.2
67 0.2
68 0.2
69 0.2
70 0.24
71 0.31
72 0.36
73 0.37
74 0.37
75 0.38
76 0.39
77 0.38
78 0.37
79 0.32
80 0.25
81 0.24
82 0.22
83 0.2
84 0.19
85 0.19
86 0.17
87 0.16
88 0.17
89 0.2
90 0.21
91 0.25
92 0.25
93 0.3
94 0.33
95 0.37
96 0.43
97 0.4
98 0.39
99 0.38
100 0.39
101 0.38
102 0.46
103 0.47
104 0.45
105 0.5
106 0.55
107 0.57
108 0.58
109 0.56
110 0.48
111 0.46
112 0.46
113 0.42
114 0.45
115 0.44
116 0.45
117 0.51
118 0.58
119 0.64
120 0.68
121 0.7
122 0.67
123 0.7
124 0.66
125 0.58
126 0.5
127 0.41
128 0.37
129 0.34
130 0.29
131 0.24
132 0.23
133 0.21
134 0.23
135 0.28
136 0.25
137 0.25
138 0.28
139 0.3
140 0.34
141 0.36
142 0.37
143 0.37
144 0.34
145 0.3
146 0.3
147 0.27
148 0.25
149 0.24
150 0.25
151 0.24
152 0.26
153 0.27
154 0.24
155 0.22
156 0.22
157 0.23
158 0.24
159 0.21
160 0.21
161 0.2
162 0.19
163 0.2
164 0.19
165 0.16
166 0.14
167 0.13
168 0.17
169 0.19
170 0.24
171 0.23
172 0.24
173 0.24
174 0.25
175 0.32
176 0.35
177 0.35
178 0.33
179 0.33
180 0.35
181 0.38
182 0.4
183 0.39
184 0.34
185 0.38
186 0.36
187 0.38
188 0.4
189 0.38
190 0.37
191 0.31
192 0.33
193 0.3
194 0.34