Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3KVE9

Protein Details
Accession E3KVE9    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
156-186SILREMQKSRDKKSKRKARCRRKRKRQGKSKBasic
NLS Segment(s)
PositionSequence
163-186KSRDKKSKRKARCRRKRKRQGKSK
Subcellular Location(s) extr 8, plas 5, nucl 4, mito 3, golg 3, E.R. 2
Family & Domain DBs
KEGG pgr:PGTG_14328  -  
Amino Acid Sequences MLKISIIMLLGSALSYVLAAPVYHLIPATPVVSLPDTCPAVQFPMERPAHLQTEDILGHASSTGMHPADPQLTMDPPDYLPKEVPRKLTDEERRKIVDILRNYPPGHAYRINESPYPIRLAKAYWERGWDGGRVRVYDENDILLHDTGYFHFNAGSILREMQKSRDKKSKRKARCRRKRKRQGKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.03
4 0.04
5 0.04
6 0.04
7 0.05
8 0.08
9 0.08
10 0.08
11 0.08
12 0.08
13 0.08
14 0.1
15 0.1
16 0.07
17 0.07
18 0.09
19 0.11
20 0.12
21 0.12
22 0.15
23 0.16
24 0.16
25 0.17
26 0.16
27 0.16
28 0.18
29 0.18
30 0.16
31 0.24
32 0.24
33 0.24
34 0.26
35 0.28
36 0.28
37 0.27
38 0.25
39 0.16
40 0.19
41 0.19
42 0.16
43 0.13
44 0.1
45 0.09
46 0.09
47 0.08
48 0.05
49 0.05
50 0.07
51 0.06
52 0.06
53 0.07
54 0.08
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.11
61 0.11
62 0.11
63 0.1
64 0.14
65 0.14
66 0.14
67 0.15
68 0.19
69 0.26
70 0.28
71 0.31
72 0.29
73 0.32
74 0.33
75 0.41
76 0.45
77 0.47
78 0.47
79 0.47
80 0.46
81 0.43
82 0.42
83 0.37
84 0.33
85 0.28
86 0.3
87 0.3
88 0.33
89 0.32
90 0.31
91 0.29
92 0.25
93 0.25
94 0.24
95 0.21
96 0.22
97 0.26
98 0.28
99 0.27
100 0.27
101 0.25
102 0.22
103 0.25
104 0.21
105 0.18
106 0.16
107 0.16
108 0.21
109 0.26
110 0.29
111 0.26
112 0.28
113 0.29
114 0.3
115 0.31
116 0.27
117 0.22
118 0.23
119 0.24
120 0.22
121 0.23
122 0.25
123 0.26
124 0.26
125 0.24
126 0.2
127 0.19
128 0.19
129 0.18
130 0.14
131 0.12
132 0.09
133 0.09
134 0.08
135 0.1
136 0.1
137 0.08
138 0.08
139 0.08
140 0.09
141 0.09
142 0.11
143 0.1
144 0.13
145 0.15
146 0.18
147 0.19
148 0.25
149 0.33
150 0.37
151 0.44
152 0.52
153 0.59
154 0.67
155 0.77
156 0.81
157 0.83
158 0.89
159 0.92
160 0.93
161 0.95
162 0.96
163 0.96
164 0.97
165 0.97
166 0.97