Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KNC4

Protein Details
Accession E3KNC4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MNNSQPRSNPNGKRKRESKKQRAGAEEEEHydrophilic
NLS Segment(s)
PositionSequence
11-22NGKRKRESKKQR
Subcellular Location(s) nucl 15.5, cyto_nucl 11, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR029028  Alpha/beta_knot_MTases  
IPR005304  Rbsml_bgen_MeTrfase_EMG1/NEP1  
IPR029026  tRNA_m1G_MTases_N  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005737  C:cytoplasm  
GO:0005880  C:nuclear microtubule  
GO:0034399  C:nuclear periphery  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0042802  F:identical protein binding  
GO:0070037  F:rRNA (pseudouridine) methyltransferase activity  
GO:0019843  F:rRNA binding  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0070475  P:rRNA base methylation  
KEGG pgr:PGTG_11089  -  
Pfam View protein in Pfam  
PF03587  EMG1  
CDD cd18088  Nep1-like  
Amino Acid Sequences MNNSQPRSNPNGKRKRESKKQRAGAEEEEEGRGAGQPLPSSLSNPLMLPVAPSTGPPKDSDSAPKLIVVLSQACLENYAQTVKQSSASSSKSKASSAKKQVKYTLLNCDDHQSILAKMGKDIAATRPDITHQCLLTLLDSPVNRAGRLQVYIHTAAGVLIEIHPTVRIPRTFKRFSGLMVQLLHQLSIKSTTGKEKLLKVIKNPISDHLPLNSHKITLSFDAPPVKVSEYVTTIPSDKHLVVFVGAMAHGADDFADHLVDEKIAISQYSLSASVACGKFCCAVEDHWGIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.88
3 0.89
4 0.9
5 0.9
6 0.91
7 0.91
8 0.88
9 0.85
10 0.81
11 0.76
12 0.7
13 0.62
14 0.53
15 0.45
16 0.37
17 0.3
18 0.23
19 0.18
20 0.14
21 0.12
22 0.12
23 0.12
24 0.12
25 0.16
26 0.16
27 0.17
28 0.18
29 0.19
30 0.18
31 0.18
32 0.18
33 0.15
34 0.15
35 0.14
36 0.12
37 0.11
38 0.1
39 0.11
40 0.15
41 0.16
42 0.17
43 0.18
44 0.22
45 0.22
46 0.25
47 0.31
48 0.31
49 0.32
50 0.32
51 0.3
52 0.26
53 0.23
54 0.22
55 0.16
56 0.13
57 0.1
58 0.12
59 0.11
60 0.11
61 0.12
62 0.12
63 0.1
64 0.1
65 0.12
66 0.1
67 0.11
68 0.13
69 0.12
70 0.15
71 0.15
72 0.16
73 0.2
74 0.23
75 0.26
76 0.27
77 0.3
78 0.28
79 0.3
80 0.35
81 0.37
82 0.43
83 0.51
84 0.59
85 0.6
86 0.63
87 0.66
88 0.65
89 0.64
90 0.57
91 0.57
92 0.51
93 0.47
94 0.43
95 0.41
96 0.35
97 0.29
98 0.26
99 0.17
100 0.12
101 0.15
102 0.18
103 0.14
104 0.14
105 0.15
106 0.15
107 0.14
108 0.15
109 0.13
110 0.13
111 0.13
112 0.14
113 0.13
114 0.15
115 0.16
116 0.18
117 0.18
118 0.15
119 0.14
120 0.14
121 0.14
122 0.13
123 0.12
124 0.09
125 0.09
126 0.09
127 0.1
128 0.14
129 0.14
130 0.14
131 0.12
132 0.14
133 0.12
134 0.14
135 0.13
136 0.11
137 0.14
138 0.14
139 0.14
140 0.12
141 0.11
142 0.09
143 0.09
144 0.07
145 0.04
146 0.03
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.06
153 0.09
154 0.12
155 0.17
156 0.24
157 0.32
158 0.35
159 0.35
160 0.38
161 0.35
162 0.34
163 0.37
164 0.32
165 0.27
166 0.25
167 0.25
168 0.24
169 0.24
170 0.22
171 0.15
172 0.13
173 0.1
174 0.12
175 0.12
176 0.1
177 0.12
178 0.18
179 0.2
180 0.24
181 0.27
182 0.27
183 0.35
184 0.41
185 0.42
186 0.39
187 0.47
188 0.47
189 0.49
190 0.47
191 0.42
192 0.4
193 0.39
194 0.37
195 0.29
196 0.28
197 0.25
198 0.3
199 0.27
200 0.22
201 0.21
202 0.2
203 0.2
204 0.19
205 0.21
206 0.16
207 0.19
208 0.22
209 0.22
210 0.22
211 0.21
212 0.2
213 0.19
214 0.19
215 0.18
216 0.18
217 0.19
218 0.2
219 0.19
220 0.19
221 0.18
222 0.18
223 0.19
224 0.16
225 0.15
226 0.15
227 0.14
228 0.13
229 0.13
230 0.11
231 0.08
232 0.08
233 0.07
234 0.06
235 0.05
236 0.05
237 0.05
238 0.04
239 0.03
240 0.04
241 0.05
242 0.05
243 0.05
244 0.06
245 0.07
246 0.07
247 0.07
248 0.07
249 0.07
250 0.08
251 0.08
252 0.08
253 0.08
254 0.09
255 0.11
256 0.11
257 0.1
258 0.1
259 0.11
260 0.18
261 0.18
262 0.18
263 0.17
264 0.19
265 0.22
266 0.22
267 0.24
268 0.18
269 0.2
270 0.26