Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KG70

Protein Details
Accession E3KG70    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
34-54TPSASCYSTHRNKNKNSQVAGHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 21, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036749  Expansin_CBD_sf  
IPR036908  RlpA-like_sf  
KEGG pgr:PGTG_09119  -  
CDD cd22271  DPBB_EXP_N-like  
Amino Acid Sequences MYAGYYFLLLTLLALQAVAKPLNSHSARVNKRETPSASCYSTHRNKNKNSQVAGRTYHGEATTWNASWATGNCLFQKWPQPKGLGPIAMASNLWNSSGICGACISITGPVGTHKGVVSDQCPSCKKDSLDLGPDLWKEVSNGQNPGVLPITWEIVPCNFSTPIEFINKDGVSKDWNSIQVAGAEVPIRSLEVMPIANESSGGTGQRSWIRLTKQSNSNYFQPESGKGLGKSADIKVTCDNGKKIITKNVELDKPLNITDAVGNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.1
5 0.1
6 0.09
7 0.1
8 0.12
9 0.21
10 0.23
11 0.24
12 0.28
13 0.38
14 0.45
15 0.5
16 0.56
17 0.53
18 0.56
19 0.62
20 0.58
21 0.55
22 0.55
23 0.54
24 0.49
25 0.45
26 0.44
27 0.46
28 0.51
29 0.54
30 0.57
31 0.6
32 0.66
33 0.75
34 0.82
35 0.8
36 0.76
37 0.74
38 0.7
39 0.67
40 0.62
41 0.54
42 0.46
43 0.39
44 0.37
45 0.29
46 0.23
47 0.18
48 0.2
49 0.2
50 0.17
51 0.17
52 0.14
53 0.14
54 0.16
55 0.16
56 0.16
57 0.16
58 0.18
59 0.19
60 0.2
61 0.21
62 0.22
63 0.31
64 0.3
65 0.32
66 0.34
67 0.35
68 0.35
69 0.4
70 0.4
71 0.32
72 0.27
73 0.24
74 0.21
75 0.19
76 0.17
77 0.12
78 0.1
79 0.09
80 0.09
81 0.07
82 0.06
83 0.07
84 0.09
85 0.09
86 0.08
87 0.07
88 0.07
89 0.06
90 0.07
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.08
100 0.07
101 0.08
102 0.08
103 0.09
104 0.09
105 0.14
106 0.14
107 0.19
108 0.21
109 0.22
110 0.24
111 0.27
112 0.27
113 0.25
114 0.29
115 0.28
116 0.3
117 0.28
118 0.27
119 0.24
120 0.23
121 0.2
122 0.15
123 0.12
124 0.09
125 0.12
126 0.16
127 0.16
128 0.17
129 0.17
130 0.19
131 0.18
132 0.19
133 0.17
134 0.12
135 0.1
136 0.09
137 0.1
138 0.08
139 0.09
140 0.08
141 0.07
142 0.09
143 0.08
144 0.1
145 0.09
146 0.09
147 0.1
148 0.11
149 0.13
150 0.15
151 0.15
152 0.14
153 0.19
154 0.19
155 0.18
156 0.17
157 0.16
158 0.15
159 0.16
160 0.17
161 0.14
162 0.16
163 0.17
164 0.17
165 0.16
166 0.14
167 0.14
168 0.12
169 0.1
170 0.09
171 0.08
172 0.07
173 0.07
174 0.06
175 0.06
176 0.06
177 0.05
178 0.07
179 0.07
180 0.07
181 0.09
182 0.09
183 0.08
184 0.08
185 0.08
186 0.08
187 0.08
188 0.08
189 0.08
190 0.08
191 0.12
192 0.15
193 0.17
194 0.18
195 0.22
196 0.26
197 0.33
198 0.39
199 0.43
200 0.48
201 0.54
202 0.58
203 0.58
204 0.59
205 0.57
206 0.52
207 0.47
208 0.41
209 0.37
210 0.34
211 0.33
212 0.32
213 0.26
214 0.28
215 0.26
216 0.25
217 0.26
218 0.24
219 0.27
220 0.23
221 0.26
222 0.27
223 0.31
224 0.33
225 0.35
226 0.35
227 0.33
228 0.38
229 0.41
230 0.42
231 0.46
232 0.48
233 0.47
234 0.52
235 0.56
236 0.54
237 0.53
238 0.5
239 0.44
240 0.41
241 0.37
242 0.31
243 0.23
244 0.2