Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KHA9

Protein Details
Accession E3KHA9    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
112-140RMVAVWERRKIRNKSKRNKQQTKYPLLRLHydrophilic
NLS Segment(s)
PositionSequence
72-95RKREELANRKANHRANPRIKYKSK
119-130RRKIRNKSKRNK
Subcellular Location(s) mito_nucl 13.666, nucl 13.5, mito 12.5, cyto_nucl 8.333
Family & Domain DBs
KEGG pgr:PGTG_09397  -  
Amino Acid Sequences MSNKLSTVINNAVKKGRNRQVISTPDSATKVFVVEQEVYEPGSLEIETRLKKITGLVATSLPGRIKSAVIVRKREELANRKANHRANPRIKYKSKSYKSLEKSFTNSRISWRMVAVWERRKIRNKSKRNKQQTKYPLLRLVVRNRGITGIAVKGKLEVEID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.54
3 0.55
4 0.57
5 0.59
6 0.62
7 0.65
8 0.66
9 0.66
10 0.59
11 0.52
12 0.45
13 0.44
14 0.38
15 0.3
16 0.23
17 0.18
18 0.15
19 0.14
20 0.14
21 0.13
22 0.13
23 0.14
24 0.14
25 0.13
26 0.13
27 0.12
28 0.08
29 0.08
30 0.07
31 0.06
32 0.08
33 0.12
34 0.13
35 0.14
36 0.15
37 0.15
38 0.15
39 0.16
40 0.19
41 0.16
42 0.16
43 0.16
44 0.15
45 0.16
46 0.16
47 0.16
48 0.12
49 0.1
50 0.1
51 0.09
52 0.09
53 0.1
54 0.16
55 0.21
56 0.26
57 0.3
58 0.31
59 0.34
60 0.35
61 0.35
62 0.36
63 0.37
64 0.41
65 0.44
66 0.44
67 0.43
68 0.5
69 0.51
70 0.52
71 0.52
72 0.54
73 0.55
74 0.61
75 0.65
76 0.67
77 0.68
78 0.65
79 0.66
80 0.67
81 0.63
82 0.65
83 0.63
84 0.64
85 0.66
86 0.7
87 0.66
88 0.58
89 0.58
90 0.56
91 0.56
92 0.5
93 0.43
94 0.39
95 0.39
96 0.38
97 0.34
98 0.28
99 0.24
100 0.23
101 0.28
102 0.32
103 0.35
104 0.4
105 0.44
106 0.51
107 0.59
108 0.65
109 0.71
110 0.73
111 0.76
112 0.8
113 0.87
114 0.9
115 0.92
116 0.94
117 0.89
118 0.89
119 0.88
120 0.88
121 0.84
122 0.8
123 0.75
124 0.68
125 0.69
126 0.65
127 0.64
128 0.62
129 0.59
130 0.53
131 0.47
132 0.45
133 0.39
134 0.33
135 0.27
136 0.24
137 0.23
138 0.22
139 0.21
140 0.21
141 0.21