Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2GSP4

Protein Details
Accession Q2GSP4    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
383-405EKLLPLPPTRCTRRKNCSCLHLWHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 14.5, cyto_nucl 12, nucl 6.5, mito 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001764  Glyco_hydro_3_N  
IPR036962  Glyco_hydro_3_N_sf  
IPR017853  Glycoside_hydrolase_SF  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF00933  Glyco_hydro_3  
Amino Acid Sequences MTNLDADLDPLWQDLDWAIGQMLIMGWDGTEVTPQIRNLIEQHHVGSILLTAKNLKSKLVQELQTIAHQAGHPHPLLIALDQENGGVNSLFDEDYICQFPSSMGQAAASSAELSYKIAKATATEISAVGVNLILGPVLDVLTNARYQPLGVRAIGDDPQEVSQYGIASMNGYKDAGLATCGKHFPSYGNLDFLGSSLDIPIITQTLEELSLSALVPFRNAIATGNLDAMFIGGCGITNPSMSVNHACLSEQVIDDLLRNELGFQGVAISECLEMEGLRNEIGVRTGTVMAVEAGCDLVLLCRAYDVQLEAIAGLKLGVENELITKERIYTSLKRIFRMKKSCTSWQKALNPPGISLLSKIHPGHLALSLKAYDDSIAVIRDNEKLLPLPPTRCTRRKNCSCLHLW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.09
3 0.09
4 0.09
5 0.09
6 0.08
7 0.08
8 0.08
9 0.08
10 0.06
11 0.06
12 0.05
13 0.05
14 0.05
15 0.06
16 0.05
17 0.07
18 0.07
19 0.09
20 0.13
21 0.13
22 0.16
23 0.16
24 0.18
25 0.19
26 0.23
27 0.25
28 0.23
29 0.25
30 0.23
31 0.23
32 0.21
33 0.18
34 0.16
35 0.16
36 0.15
37 0.14
38 0.16
39 0.18
40 0.24
41 0.24
42 0.24
43 0.24
44 0.28
45 0.36
46 0.4
47 0.41
48 0.37
49 0.41
50 0.4
51 0.38
52 0.35
53 0.27
54 0.22
55 0.19
56 0.2
57 0.19
58 0.22
59 0.2
60 0.19
61 0.18
62 0.17
63 0.17
64 0.15
65 0.15
66 0.12
67 0.12
68 0.12
69 0.12
70 0.12
71 0.11
72 0.11
73 0.08
74 0.06
75 0.06
76 0.07
77 0.07
78 0.06
79 0.08
80 0.08
81 0.11
82 0.13
83 0.12
84 0.11
85 0.11
86 0.12
87 0.13
88 0.14
89 0.13
90 0.11
91 0.11
92 0.11
93 0.11
94 0.11
95 0.09
96 0.07
97 0.05
98 0.06
99 0.05
100 0.06
101 0.08
102 0.08
103 0.09
104 0.09
105 0.09
106 0.1
107 0.12
108 0.13
109 0.12
110 0.12
111 0.12
112 0.12
113 0.12
114 0.11
115 0.08
116 0.06
117 0.05
118 0.04
119 0.04
120 0.03
121 0.02
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.04
128 0.06
129 0.06
130 0.06
131 0.07
132 0.07
133 0.07
134 0.09
135 0.12
136 0.13
137 0.12
138 0.13
139 0.13
140 0.15
141 0.16
142 0.14
143 0.11
144 0.1
145 0.1
146 0.1
147 0.1
148 0.09
149 0.08
150 0.07
151 0.08
152 0.07
153 0.06
154 0.07
155 0.07
156 0.07
157 0.07
158 0.07
159 0.06
160 0.06
161 0.06
162 0.05
163 0.06
164 0.07
165 0.07
166 0.09
167 0.1
168 0.1
169 0.11
170 0.11
171 0.1
172 0.14
173 0.19
174 0.18
175 0.19
176 0.18
177 0.18
178 0.18
179 0.17
180 0.13
181 0.07
182 0.06
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.04
194 0.04
195 0.04
196 0.03
197 0.04
198 0.04
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.06
208 0.06
209 0.07
210 0.07
211 0.08
212 0.08
213 0.08
214 0.08
215 0.07
216 0.06
217 0.04
218 0.04
219 0.03
220 0.02
221 0.03
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.06
228 0.08
229 0.09
230 0.1
231 0.1
232 0.11
233 0.11
234 0.1
235 0.12
236 0.12
237 0.1
238 0.09
239 0.09
240 0.09
241 0.1
242 0.1
243 0.08
244 0.07
245 0.06
246 0.06
247 0.06
248 0.06
249 0.05
250 0.04
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.05
258 0.05
259 0.04
260 0.04
261 0.05
262 0.06
263 0.07
264 0.06
265 0.07
266 0.07
267 0.07
268 0.08
269 0.08
270 0.07
271 0.08
272 0.08
273 0.08
274 0.08
275 0.08
276 0.07
277 0.07
278 0.06
279 0.05
280 0.04
281 0.04
282 0.04
283 0.03
284 0.03
285 0.06
286 0.06
287 0.06
288 0.06
289 0.07
290 0.07
291 0.08
292 0.09
293 0.08
294 0.08
295 0.08
296 0.08
297 0.08
298 0.08
299 0.07
300 0.05
301 0.05
302 0.04
303 0.05
304 0.05
305 0.04
306 0.05
307 0.06
308 0.08
309 0.1
310 0.1
311 0.1
312 0.11
313 0.12
314 0.15
315 0.19
316 0.24
317 0.31
318 0.4
319 0.42
320 0.45
321 0.53
322 0.6
323 0.64
324 0.68
325 0.66
326 0.66
327 0.71
328 0.77
329 0.79
330 0.78
331 0.75
332 0.75
333 0.77
334 0.76
335 0.76
336 0.73
337 0.63
338 0.56
339 0.52
340 0.45
341 0.36
342 0.29
343 0.25
344 0.2
345 0.25
346 0.24
347 0.23
348 0.23
349 0.24
350 0.24
351 0.27
352 0.27
353 0.22
354 0.24
355 0.22
356 0.21
357 0.21
358 0.19
359 0.13
360 0.11
361 0.12
362 0.11
363 0.12
364 0.11
365 0.13
366 0.14
367 0.16
368 0.17
369 0.16
370 0.16
371 0.17
372 0.18
373 0.24
374 0.29
375 0.31
376 0.36
377 0.45
378 0.53
379 0.6
380 0.68
381 0.7
382 0.76
383 0.82
384 0.85
385 0.84