Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KQN3

Protein Details
Accession E3KQN3    Localization Confidence High Confidence Score 20.7
NoLS Segment(s)
PositionSequenceProtein Nature
64-90RTDENSKTRAEKKRRKSTRREAEQAAEHydrophilic
100-121EAGSRRRSGRIQKLQARKQNKLHydrophilic
156-200SKEISRKRKSTWKPPSGPKRPRGSLPPQRKAKSLKGHRPNPKIFGBasic
NLS Segment(s)
PositionSequence
71-84TRAEKKRRKSTRRE
104-109RRRSGR
160-196SRKRKSTWKPPSGPKRPRGSLPPQRKAKSLKGHRPNP
Subcellular Location(s) nucl 19, cyto_nucl 14.833, mito_nucl 10.499, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015947  PUA-like_sf  
IPR036987  SRA-YDG_sf  
IPR003105  SRA_YDG  
IPR045134  UHRF1/2-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0061630  F:ubiquitin protein ligase activity  
GO:0044027  P:negative regulation of gene expression via CpG island methylation  
GO:0016567  P:protein ubiquitination  
KEGG pgr:PGTG_12990  -  
Pfam View protein in Pfam  
PF02182  SAD_SRA  
PROSITE View protein in PROSITE  
PS51015  YDG  
Amino Acid Sequences MVASTLAPTKESYEEIRQRNIAATYGVIRKLIHGSQQIAVYCCPYNSPAPGANPQPHSDDRDERTDENSKTRAEKKRRKSTRREAEQAAEGEGDEKPQEEAGSRRRSGRIQKLQARKQNKLAGVEDERSEGSEESEDEYDDQDGPDGGDSSDGSESKEISRKRKSTWKPPSGPKRPRGSLPPQRKAKSLKGHRPNPKIFGQQVGTEVGDWWDSRMLCSQAGVHAPPVCGIAGSDGVGCYSVALSGGYEDDVDLGYAFTFTGSGGRALSGTKENPKNLRTAPQSSDQEFTAMNASVRLSCELKNPVRVIRGFKNHSPFAPESGYRYDGLYRVEKAWREAGQSGFQVCKPKIPVKPGREAEAEQILRDMGIATEELLEIVAQTQEWTQKLAKQRIEEQRRQRQCATEAGGADGKDEQPEETADPDAEGPVKAVADAATEDPVETSKLTPSPQNTQDVGSSSLEPERCSDKPAEPNQPVDDQEAHPAAPRSPKAVPDEPAVLSSVEKTGDEADPPSGEESATKTVDDGRSALETDLGGPERVASLPDKHSASKPVPEKTPSATVPLVESLDKEMATVASDSEVVVNDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.44
3 0.5
4 0.48
5 0.47
6 0.49
7 0.44
8 0.35
9 0.27
10 0.24
11 0.23
12 0.27
13 0.27
14 0.24
15 0.23
16 0.23
17 0.28
18 0.28
19 0.29
20 0.29
21 0.31
22 0.33
23 0.37
24 0.37
25 0.33
26 0.32
27 0.28
28 0.24
29 0.22
30 0.2
31 0.19
32 0.2
33 0.21
34 0.25
35 0.26
36 0.29
37 0.35
38 0.4
39 0.44
40 0.44
41 0.44
42 0.46
43 0.44
44 0.46
45 0.46
46 0.47
47 0.45
48 0.49
49 0.51
50 0.46
51 0.48
52 0.51
53 0.47
54 0.46
55 0.46
56 0.41
57 0.45
58 0.53
59 0.57
60 0.61
61 0.68
62 0.72
63 0.8
64 0.88
65 0.91
66 0.93
67 0.94
68 0.94
69 0.93
70 0.9
71 0.85
72 0.78
73 0.74
74 0.64
75 0.54
76 0.42
77 0.32
78 0.26
79 0.2
80 0.16
81 0.1
82 0.09
83 0.08
84 0.09
85 0.09
86 0.1
87 0.17
88 0.25
89 0.33
90 0.35
91 0.39
92 0.42
93 0.49
94 0.57
95 0.61
96 0.63
97 0.65
98 0.72
99 0.78
100 0.84
101 0.86
102 0.84
103 0.79
104 0.76
105 0.74
106 0.68
107 0.63
108 0.56
109 0.53
110 0.5
111 0.46
112 0.38
113 0.33
114 0.29
115 0.24
116 0.24
117 0.17
118 0.13
119 0.12
120 0.12
121 0.13
122 0.13
123 0.12
124 0.11
125 0.12
126 0.12
127 0.11
128 0.1
129 0.08
130 0.08
131 0.08
132 0.07
133 0.07
134 0.06
135 0.07
136 0.06
137 0.08
138 0.1
139 0.1
140 0.1
141 0.1
142 0.11
143 0.14
144 0.21
145 0.24
146 0.31
147 0.4
148 0.43
149 0.48
150 0.58
151 0.64
152 0.68
153 0.75
154 0.77
155 0.76
156 0.83
157 0.88
158 0.88
159 0.89
160 0.86
161 0.85
162 0.77
163 0.73
164 0.71
165 0.71
166 0.7
167 0.72
168 0.73
169 0.73
170 0.71
171 0.72
172 0.7
173 0.69
174 0.69
175 0.69
176 0.69
177 0.7
178 0.78
179 0.82
180 0.85
181 0.8
182 0.75
183 0.7
184 0.65
185 0.56
186 0.52
187 0.43
188 0.35
189 0.32
190 0.29
191 0.23
192 0.17
193 0.16
194 0.11
195 0.1
196 0.09
197 0.08
198 0.09
199 0.09
200 0.1
201 0.12
202 0.13
203 0.12
204 0.13
205 0.12
206 0.12
207 0.14
208 0.13
209 0.12
210 0.13
211 0.13
212 0.13
213 0.13
214 0.1
215 0.09
216 0.08
217 0.07
218 0.06
219 0.06
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.04
226 0.03
227 0.03
228 0.03
229 0.03
230 0.03
231 0.03
232 0.04
233 0.04
234 0.04
235 0.03
236 0.04
237 0.03
238 0.04
239 0.03
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.03
246 0.03
247 0.04
248 0.04
249 0.05
250 0.05
251 0.05
252 0.06
253 0.06
254 0.07
255 0.09
256 0.1
257 0.17
258 0.21
259 0.24
260 0.28
261 0.29
262 0.31
263 0.3
264 0.36
265 0.33
266 0.34
267 0.34
268 0.37
269 0.39
270 0.37
271 0.37
272 0.3
273 0.26
274 0.21
275 0.19
276 0.13
277 0.1
278 0.08
279 0.07
280 0.08
281 0.07
282 0.08
283 0.09
284 0.09
285 0.09
286 0.13
287 0.19
288 0.2
289 0.24
290 0.25
291 0.25
292 0.28
293 0.29
294 0.31
295 0.31
296 0.37
297 0.37
298 0.39
299 0.43
300 0.4
301 0.39
302 0.39
303 0.33
304 0.29
305 0.28
306 0.24
307 0.21
308 0.22
309 0.24
310 0.18
311 0.18
312 0.16
313 0.15
314 0.17
315 0.16
316 0.15
317 0.16
318 0.19
319 0.19
320 0.2
321 0.23
322 0.21
323 0.22
324 0.23
325 0.22
326 0.21
327 0.21
328 0.2
329 0.17
330 0.18
331 0.21
332 0.19
333 0.21
334 0.23
335 0.28
336 0.31
337 0.39
338 0.47
339 0.46
340 0.56
341 0.54
342 0.54
343 0.5
344 0.47
345 0.41
346 0.39
347 0.34
348 0.24
349 0.23
350 0.19
351 0.16
352 0.14
353 0.12
354 0.04
355 0.04
356 0.04
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.04
363 0.03
364 0.04
365 0.04
366 0.03
367 0.04
368 0.05
369 0.08
370 0.09
371 0.11
372 0.12
373 0.16
374 0.25
375 0.32
376 0.35
377 0.35
378 0.44
379 0.52
380 0.61
381 0.65
382 0.67
383 0.7
384 0.74
385 0.76
386 0.7
387 0.64
388 0.58
389 0.55
390 0.5
391 0.43
392 0.35
393 0.32
394 0.31
395 0.26
396 0.24
397 0.19
398 0.13
399 0.11
400 0.11
401 0.09
402 0.08
403 0.09
404 0.1
405 0.1
406 0.1
407 0.1
408 0.1
409 0.1
410 0.09
411 0.09
412 0.08
413 0.07
414 0.07
415 0.07
416 0.06
417 0.06
418 0.06
419 0.06
420 0.07
421 0.07
422 0.07
423 0.07
424 0.08
425 0.08
426 0.08
427 0.08
428 0.08
429 0.08
430 0.1
431 0.12
432 0.13
433 0.18
434 0.21
435 0.28
436 0.32
437 0.36
438 0.35
439 0.34
440 0.34
441 0.32
442 0.31
443 0.25
444 0.22
445 0.18
446 0.21
447 0.2
448 0.19
449 0.19
450 0.22
451 0.21
452 0.23
453 0.26
454 0.28
455 0.36
456 0.43
457 0.51
458 0.48
459 0.52
460 0.51
461 0.51
462 0.46
463 0.41
464 0.37
465 0.28
466 0.3
467 0.27
468 0.23
469 0.23
470 0.23
471 0.22
472 0.26
473 0.26
474 0.26
475 0.27
476 0.32
477 0.37
478 0.41
479 0.41
480 0.38
481 0.4
482 0.36
483 0.35
484 0.31
485 0.23
486 0.18
487 0.16
488 0.14
489 0.11
490 0.1
491 0.1
492 0.12
493 0.13
494 0.14
495 0.14
496 0.14
497 0.14
498 0.15
499 0.16
500 0.13
501 0.12
502 0.12
503 0.14
504 0.18
505 0.18
506 0.17
507 0.16
508 0.22
509 0.24
510 0.24
511 0.21
512 0.18
513 0.19
514 0.2
515 0.2
516 0.15
517 0.13
518 0.13
519 0.16
520 0.16
521 0.14
522 0.13
523 0.13
524 0.13
525 0.13
526 0.14
527 0.13
528 0.16
529 0.2
530 0.26
531 0.28
532 0.3
533 0.34
534 0.39
535 0.41
536 0.45
537 0.48
538 0.5
539 0.53
540 0.53
541 0.54
542 0.51
543 0.55
544 0.47
545 0.45
546 0.4
547 0.34
548 0.33
549 0.32
550 0.29
551 0.21
552 0.21
553 0.19
554 0.2
555 0.19
556 0.16
557 0.15
558 0.13
559 0.14
560 0.13
561 0.1
562 0.09
563 0.09
564 0.09
565 0.1