FuNGI

E3KQN3

Protein Details

Accession

E3KQN3

Localization Confidence

High

Confidence Score

20.7

NoLS Segment(s)

Position	Sequence	Protein Nature
64-90	RTDENSKTRAEKKRRKSTRREAEQAAE	Hydrophilic
100-121	EAGSRRRSGRIQKLQARKQNKL	Hydrophilic
156-200	SKEISRKRKSTWKPPSGPKRPRGSLPPQRKAKSLKGHRPNPKIFG	Basic

NLS Segment(s)

Position	Sequence
71-84	TRAEKKRRKSTRRE
104-109	RRRSGR
160-196	SRKRKSTWKPPSGPKRPRGSLPPQRKAKSLKGHRPNP

Subcellular Location(s)

nucl 19, cyto_nucl 14.833, mito_nucl 10.499, cyto 7.5

Family & Domain DBs

InterPro	View protein in InterPro IPR015947 PUA-like_sf IPR036987 SRA-YDG_sf IPR003105 SRA_YDG IPR045134 UHRF1/2-like
Gene Ontology	GO:0005634 C:nucleus GO:0061630 F:ubiquitin protein ligase activity GO:0044027 P:negative regulation of gene expression via CpG island methylation GO:0016567 P:protein ubiquitination
KEGG	pgr:PGTG_12990 -
Pfam	View protein in Pfam PF02182 SAD_SRA
PROSITE	View protein in PROSITE PS51015 YDG

Amino Acid Sequences

MVASTLAPTKESYEEIRQRNIAATYGVIRKLIHGSQQIAVYCCPYNSPAPGANPQPHSDDRDERTDENSKTRAEKKRRKSTRREAEQAAEGEGDEKPQEEAGSRRRSGRIQKLQARKQNKLAGVEDERSEGSEESEDEYDDQDGPDGGDSSDGSESKEISRKRKSTWKPPSGPKRPRGSLPPQRKAKSLKGHRPNPKIFGQQVGTEVGDWWDSRMLCSQAGVHAPPVCGIAGSDGVGCYSVALSGGYEDDVDLGYAFTFTGSGGRALSGTKENPKNLRTAPQSSDQEFTAMNASVRLSCELKNPVRVIRGFKNHSPFAPESGYRYDGLYRVEKAWREAGQSGFQVCKPKIPVKPGREAEAEQILRDMGIATEELLEIVAQTQEWTQKLAKQRIEEQRRQRQCATEAGGADGKDEQPEETADPDAEGPVKAVADAATEDPVETSKLTPSPQNTQDVGSSSLEPERCSDKPAEPNQPVDDQEAHPAAPRSPKAVPDEPAVLSSVEKTGDEADPPSGEESATKTVDDGRSALETDLGGPERVASLPDKHSASKPVPEKTPSATVPLVESLDKEMATVASDSEVVVNDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.4
2	0.44
3	0.5
4	0.48
5	0.47
6	0.49
7	0.44
8	0.35
9	0.27
10	0.24
11	0.23
12	0.27
13	0.27
14	0.24
15	0.23
16	0.23
17	0.28
18	0.28
19	0.29
20	0.29
21	0.31
22	0.33
23	0.37
24	0.37
25	0.33
26	0.32
27	0.28
28	0.24
29	0.22
30	0.2
31	0.19
32	0.2
33	0.21
34	0.25
35	0.26
36	0.29
37	0.35
38	0.4
39	0.44
40	0.44
41	0.44
42	0.46
43	0.44
44	0.46
45	0.46
46	0.47
47	0.45
48	0.49
49	0.51
50	0.46
51	0.48
52	0.51
53	0.47
54	0.46
55	0.46
56	0.41
57	0.45
58	0.53
59	0.57
60	0.61
61	0.68
62	0.72
63	0.8
64	0.88
65	0.91
66	0.93
67	0.94
68	0.94
69	0.93
70	0.9
71	0.85
72	0.78
73	0.74
74	0.64
75	0.54
76	0.42
77	0.32
78	0.26
79	0.2
80	0.16
81	0.1
82	0.09
83	0.08
84	0.09
85	0.09
86	0.1
87	0.17
88	0.25
89	0.33
90	0.35
91	0.39
92	0.42
93	0.49
94	0.57
95	0.61
96	0.63
97	0.65
98	0.72
99	0.78
100	0.84
101	0.86
102	0.84
103	0.79
104	0.76
105	0.74
106	0.68
107	0.63
108	0.56
109	0.53
110	0.5
111	0.46
112	0.38
113	0.33
114	0.29
115	0.24
116	0.24
117	0.17
118	0.13
119	0.12
120	0.12
121	0.13
122	0.13
123	0.12
124	0.11
125	0.12
126	0.12
127	0.11
128	0.1
129	0.08
130	0.08
131	0.08
132	0.07
133	0.07
134	0.06
135	0.07
136	0.06
137	0.08
138	0.1
139	0.1
140	0.1
141	0.1
142	0.11
143	0.14
144	0.21
145	0.24
146	0.31
147	0.4
148	0.43
149	0.48
150	0.58
151	0.64
152	0.68
153	0.75
154	0.77
155	0.76
156	0.83
157	0.88
158	0.88
159	0.89
160	0.86
161	0.85
162	0.77
163	0.73
164	0.71
165	0.71
166	0.7
167	0.72
168	0.73
169	0.73
170	0.71
171	0.72
172	0.7
173	0.69
174	0.69
175	0.69
176	0.69
177	0.7
178	0.78
179	0.82
180	0.85
181	0.8
182	0.75
183	0.7
184	0.65
185	0.56
186	0.52
187	0.43
188	0.35
189	0.32
190	0.29
191	0.23
192	0.17
193	0.16
194	0.11
195	0.1
196	0.09
197	0.08
198	0.09
199	0.09
200	0.1
201	0.12
202	0.13
203	0.12
204	0.13
205	0.12
206	0.12
207	0.14
208	0.13
209	0.12
210	0.13
211	0.13
212	0.13
213	0.13
214	0.1
215	0.09
216	0.08
217	0.07
218	0.06
219	0.06
220	0.05
221	0.05
222	0.05
223	0.05
224	0.05
225	0.04
226	0.03
227	0.03
228	0.03
229	0.03
230	0.03
231	0.03
232	0.04
233	0.04
234	0.04
235	0.03
236	0.04
237	0.03
238	0.04
239	0.03
240	0.03
241	0.03
242	0.03
243	0.03
244	0.03
245	0.03
246	0.03
247	0.04
248	0.04
249	0.05
250	0.05
251	0.05
252	0.06
253	0.06
254	0.07
255	0.09
256	0.1
257	0.17
258	0.21
259	0.24
260	0.28
261	0.29
262	0.31
263	0.3
264	0.36
265	0.33
266	0.34
267	0.34
268	0.37
269	0.39
270	0.37
271	0.37
272	0.3
273	0.26
274	0.21
275	0.19
276	0.13
277	0.1
278	0.08
279	0.07
280	0.08
281	0.07
282	0.08
283	0.09
284	0.09
285	0.09
286	0.13
287	0.19
288	0.2
289	0.24
290	0.25
291	0.25
292	0.28
293	0.29
294	0.31
295	0.31
296	0.37
297	0.37
298	0.39
299	0.43
300	0.4
301	0.39
302	0.39
303	0.33
304	0.29
305	0.28
306	0.24
307	0.21
308	0.22
309	0.24
310	0.18
311	0.18
312	0.16
313	0.15
314	0.17
315	0.16
316	0.15
317	0.16
318	0.19
319	0.19
320	0.2
321	0.23
322	0.21
323	0.22
324	0.23
325	0.22
326	0.21
327	0.21
328	0.2
329	0.17
330	0.18
331	0.21
332	0.19
333	0.21
334	0.23
335	0.28
336	0.31
337	0.39
338	0.47
339	0.46
340	0.56
341	0.54
342	0.54
343	0.5
344	0.47
345	0.41
346	0.39
347	0.34
348	0.24
349	0.23
350	0.19
351	0.16
352	0.14
353	0.12
354	0.04
355	0.04
356	0.04
357	0.04
358	0.04
359	0.04
360	0.04
361	0.04
362	0.04
363	0.03
364	0.04
365	0.04
366	0.03
367	0.04
368	0.05
369	0.08
370	0.09
371	0.11
372	0.12
373	0.16
374	0.25
375	0.32
376	0.35
377	0.35
378	0.44
379	0.52
380	0.61
381	0.65
382	0.67
383	0.7
384	0.74
385	0.76
386	0.7
387	0.64
388	0.58
389	0.55
390	0.5
391	0.43
392	0.35
393	0.32
394	0.31
395	0.26
396	0.24
397	0.19
398	0.13
399	0.11
400	0.11
401	0.09
402	0.08
403	0.09
404	0.1
405	0.1
406	0.1
407	0.1
408	0.1
409	0.1
410	0.09
411	0.09
412	0.08
413	0.07
414	0.07
415	0.07
416	0.06
417	0.06
418	0.06
419	0.06
420	0.07
421	0.07
422	0.07
423	0.07
424	0.08
425	0.08
426	0.08
427	0.08
428	0.08
429	0.08
430	0.1
431	0.12
432	0.13
433	0.18
434	0.21
435	0.28
436	0.32
437	0.36
438	0.35
439	0.34
440	0.34
441	0.32
442	0.31
443	0.25
444	0.22
445	0.18
446	0.21
447	0.2
448	0.19
449	0.19
450	0.22
451	0.21
452	0.23
453	0.26
454	0.28
455	0.36
456	0.43
457	0.51
458	0.48
459	0.52
460	0.51
461	0.51
462	0.46
463	0.41
464	0.37
465	0.28
466	0.3
467	0.27
468	0.23
469	0.23
470	0.23
471	0.22
472	0.26
473	0.26
474	0.26
475	0.27
476	0.32
477	0.37
478	0.41
479	0.41
480	0.38
481	0.4
482	0.36
483	0.35
484	0.31
485	0.23
486	0.18
487	0.16
488	0.14
489	0.11
490	0.1
491	0.1
492	0.12
493	0.13
494	0.14
495	0.14
496	0.14
497	0.14
498	0.15
499	0.16
500	0.13
501	0.12
502	0.12
503	0.14
504	0.18
505	0.18
506	0.17
507	0.16
508	0.22
509	0.24
510	0.24
511	0.21
512	0.18
513	0.19
514	0.2
515	0.2
516	0.15
517	0.13
518	0.13
519	0.16
520	0.16
521	0.14
522	0.13
523	0.13
524	0.13
525	0.13
526	0.14
527	0.13
528	0.16
529	0.2
530	0.26
531	0.28
532	0.3
533	0.34
534	0.39
535	0.41
536	0.45
537	0.48
538	0.5
539	0.53
540	0.53
541	0.54
542	0.51
543	0.55
544	0.47
545	0.45
546	0.4
547	0.34
548	0.33
549	0.32
550	0.29
551	0.21
552	0.21
553	0.19
554	0.2
555	0.19
556	0.16
557	0.15
558	0.13
559	0.14
560	0.13
561	0.1
562	0.09
563	0.09
564	0.09
565	0.1

E3KQN3

3D AlphaFold-predicted Structure Viewer