Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KHX8

Protein Details
Accession E3KHX8    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
97-134MAEKKPAVARKLRKERKNRAKKFRGTQKKKADQAAKKKBasic
NLS Segment(s)
PositionSequence
98-134AEKKPAVARKLRKERKNRAKKFRGTQKKKADQAAKKK
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgr:PGTG_09616  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
Amino Acid Sequences MDPSGSVTIRTRQFLTNRLLQRKQMIVDIIHPTRPNLSKDELRDKLSGMYKAPKEQIIVFGFRTQFGGGKSTGFALIYDTKEALKFEPKYRLIRFGMAEKKPAVARKLRKERKNRAKKFRGTQKKKADQAAKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.43
3 0.45
4 0.5
5 0.56
6 0.57
7 0.55
8 0.56
9 0.54
10 0.49
11 0.44
12 0.37
13 0.3
14 0.31
15 0.34
16 0.3
17 0.3
18 0.29
19 0.26
20 0.29
21 0.32
22 0.29
23 0.26
24 0.3
25 0.31
26 0.37
27 0.46
28 0.44
29 0.43
30 0.42
31 0.39
32 0.38
33 0.37
34 0.33
35 0.25
36 0.29
37 0.27
38 0.29
39 0.3
40 0.26
41 0.24
42 0.23
43 0.26
44 0.21
45 0.21
46 0.18
47 0.2
48 0.19
49 0.17
50 0.18
51 0.12
52 0.12
53 0.11
54 0.12
55 0.09
56 0.09
57 0.09
58 0.09
59 0.09
60 0.07
61 0.07
62 0.07
63 0.1
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.12
70 0.11
71 0.16
72 0.18
73 0.22
74 0.3
75 0.34
76 0.41
77 0.42
78 0.47
79 0.42
80 0.42
81 0.4
82 0.4
83 0.44
84 0.38
85 0.4
86 0.34
87 0.35
88 0.35
89 0.37
90 0.34
91 0.35
92 0.43
93 0.51
94 0.62
95 0.69
96 0.75
97 0.81
98 0.88
99 0.9
100 0.92
101 0.91
102 0.91
103 0.92
104 0.93
105 0.93
106 0.92
107 0.93
108 0.91
109 0.91
110 0.91
111 0.9
112 0.88
113 0.87
114 0.86