Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3KEW2

Protein Details
Accession E3KEW2    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
20-40LSNRTFFHKHDSPRRVRRGSDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001884  IF5A-like  
IPR012340  NA-bd_OB-fold  
IPR014722  Rib_L2_dom2  
IPR019769  Trans_elong_IF5A_hypusine_site  
IPR020189  Transl_elong_IF5A_C  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0043022  F:ribosome binding  
GO:0003723  F:RNA binding  
GO:0003746  F:translation elongation factor activity  
GO:0003743  F:translation initiation factor activity  
GO:0045901  P:positive regulation of translational elongation  
GO:0045905  P:positive regulation of translational termination  
GO:0006414  P:translational elongation  
KEGG pgr:PGTG_09986  -  
Pfam View protein in Pfam  
PF01287  eIF-5a  
PROSITE View protein in PROSITE  
PS00302  IF5A_HYPUSINE  
CDD cd04468  S1_eIF5A  
Amino Acid Sequences MSRLNTLQQAYSTAPALRSLSNRTFFHKHDSPRRVRRGSDPIGVLWFRRFANGVGIRFRLGHMVYVAEPQHHLLLIHLCGRSGVGLHVSEHQRSSSATSKHRSLLDSPVVTTVTLTFRSINQHTPPPCSSDDEQHNQTFEAAGAGASLTYPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKVHLVGIDIFTTRKYEDISPSTHNMDVPNVSRTEYQLVNIEDGFLNLITTDGVAKDDVKVPEGDLGDDIQAQFDAGKDLYCTITAAMGEEMCLAFKEAPKS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.21
4 0.21
5 0.23
6 0.28
7 0.34
8 0.39
9 0.4
10 0.45
11 0.48
12 0.47
13 0.53
14 0.53
15 0.55
16 0.59
17 0.68
18 0.71
19 0.76
20 0.84
21 0.81
22 0.77
23 0.76
24 0.75
25 0.71
26 0.67
27 0.58
28 0.49
29 0.49
30 0.46
31 0.38
32 0.3
33 0.27
34 0.21
35 0.21
36 0.2
37 0.16
38 0.25
39 0.3
40 0.31
41 0.31
42 0.32
43 0.32
44 0.31
45 0.3
46 0.24
47 0.19
48 0.17
49 0.13
50 0.14
51 0.13
52 0.17
53 0.17
54 0.14
55 0.14
56 0.14
57 0.14
58 0.12
59 0.12
60 0.09
61 0.11
62 0.12
63 0.16
64 0.15
65 0.14
66 0.14
67 0.14
68 0.12
69 0.1
70 0.09
71 0.07
72 0.08
73 0.09
74 0.15
75 0.17
76 0.18
77 0.18
78 0.17
79 0.16
80 0.16
81 0.2
82 0.22
83 0.25
84 0.3
85 0.33
86 0.35
87 0.38
88 0.4
89 0.37
90 0.32
91 0.33
92 0.33
93 0.29
94 0.27
95 0.25
96 0.23
97 0.21
98 0.18
99 0.13
100 0.09
101 0.1
102 0.1
103 0.09
104 0.1
105 0.15
106 0.17
107 0.2
108 0.21
109 0.27
110 0.27
111 0.32
112 0.31
113 0.3
114 0.29
115 0.3
116 0.28
117 0.28
118 0.32
119 0.33
120 0.35
121 0.32
122 0.32
123 0.27
124 0.26
125 0.19
126 0.14
127 0.09
128 0.05
129 0.04
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.05
140 0.06
141 0.09
142 0.13
143 0.2
144 0.21
145 0.22
146 0.25
147 0.29
148 0.31
149 0.32
150 0.3
151 0.3
152 0.38
153 0.42
154 0.4
155 0.37
156 0.35
157 0.34
158 0.34
159 0.3
160 0.26
161 0.27
162 0.29
163 0.34
164 0.34
165 0.31
166 0.32
167 0.31
168 0.32
169 0.34
170 0.36
171 0.34
172 0.39
173 0.42
174 0.4
175 0.4
176 0.36
177 0.28
178 0.24
179 0.19
180 0.14
181 0.11
182 0.1
183 0.08
184 0.09
185 0.08
186 0.09
187 0.1
188 0.12
189 0.17
190 0.2
191 0.24
192 0.26
193 0.29
194 0.31
195 0.29
196 0.27
197 0.23
198 0.21
199 0.21
200 0.19
201 0.19
202 0.17
203 0.18
204 0.18
205 0.19
206 0.21
207 0.18
208 0.17
209 0.2
210 0.21
211 0.2
212 0.19
213 0.19
214 0.15
215 0.15
216 0.14
217 0.08
218 0.07
219 0.06
220 0.06
221 0.04
222 0.05
223 0.05
224 0.05
225 0.06
226 0.06
227 0.07
228 0.09
229 0.15
230 0.15
231 0.17
232 0.17
233 0.16
234 0.2
235 0.2
236 0.19
237 0.14
238 0.14
239 0.13
240 0.14
241 0.13
242 0.09
243 0.09
244 0.08
245 0.07
246 0.07
247 0.09
248 0.08
249 0.08
250 0.09
251 0.1
252 0.11
253 0.11
254 0.12
255 0.09
256 0.11
257 0.1
258 0.11
259 0.11
260 0.1
261 0.1
262 0.1
263 0.1
264 0.08
265 0.09
266 0.1
267 0.11