Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KME6

Protein Details
Accession E3KME6   
Localization Confidence Medium
Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
20-44WLFSRHYRSRALRRKPPPPWFPDPHHydrophilic
269-290SLLKSGPPSASKKKKPKKKKKNBasic
NLS Segment(s)
PositionSequence
276-290PSASKKKKPKKKKKN
Subcellular Location(s) mito 14, extr 4, nucl 3, pero 3, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018624  Sec66  
Gene Ontology GO:0031207  C:Sec62/Sec63 complex  
GO:0031204  P:post-translational protein targeting to membrane, translocation  
KEGG pgr:PGTG_11827  -  
Pfam View protein in Pfam  
PF09802  Sec66  
Amino Acid Sequences MALPLYVPFGYITFLVGLLWLFSRHYRSRALRRKPPPPWFPDPHTARDVYISLLSMDPPPSQSVLVAALLARAMTDVKRIMSLKEAKQAMTNLLQKGQVGDELWERLLMAEKELDVELSEVVAEAEEYSQGWGGAIFSIASEALQATMSQEIYKDIPKQRTLKTAEIAAARAFAPNPGELRILGSKPAVPAAQATPKPASSTAPPSQAKLAMLENIRAAQAKLKSEQEKKPTTPPPASSSSSPPTGSKAHSPGSSRGDQSDSDNEGSTSLLKSGPPSASKKKKPKKKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.08
4 0.07
5 0.06
6 0.07
7 0.07
8 0.08
9 0.11
10 0.18
11 0.22
12 0.25
13 0.33
14 0.42
15 0.53
16 0.62
17 0.69
18 0.73
19 0.79
20 0.86
21 0.87
22 0.88
23 0.86
24 0.84
25 0.83
26 0.8
27 0.77
28 0.77
29 0.72
30 0.67
31 0.61
32 0.54
33 0.45
34 0.4
35 0.34
36 0.25
37 0.21
38 0.17
39 0.13
40 0.13
41 0.13
42 0.12
43 0.13
44 0.12
45 0.12
46 0.13
47 0.13
48 0.13
49 0.12
50 0.11
51 0.11
52 0.11
53 0.09
54 0.08
55 0.07
56 0.07
57 0.06
58 0.05
59 0.04
60 0.05
61 0.05
62 0.08
63 0.09
64 0.09
65 0.13
66 0.14
67 0.14
68 0.21
69 0.27
70 0.28
71 0.34
72 0.35
73 0.32
74 0.34
75 0.34
76 0.29
77 0.29
78 0.31
79 0.24
80 0.25
81 0.25
82 0.22
83 0.22
84 0.2
85 0.14
86 0.1
87 0.1
88 0.1
89 0.1
90 0.1
91 0.09
92 0.09
93 0.08
94 0.11
95 0.1
96 0.09
97 0.09
98 0.08
99 0.1
100 0.09
101 0.09
102 0.06
103 0.06
104 0.05
105 0.04
106 0.04
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.03
121 0.03
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.03
133 0.04
134 0.04
135 0.05
136 0.05
137 0.05
138 0.06
139 0.07
140 0.09
141 0.14
142 0.19
143 0.23
144 0.28
145 0.33
146 0.34
147 0.41
148 0.44
149 0.42
150 0.38
151 0.36
152 0.33
153 0.29
154 0.27
155 0.2
156 0.15
157 0.12
158 0.11
159 0.1
160 0.08
161 0.08
162 0.08
163 0.09
164 0.1
165 0.1
166 0.1
167 0.13
168 0.14
169 0.13
170 0.13
171 0.13
172 0.13
173 0.12
174 0.14
175 0.11
176 0.09
177 0.1
178 0.12
179 0.19
180 0.19
181 0.21
182 0.21
183 0.22
184 0.23
185 0.22
186 0.21
187 0.18
188 0.25
189 0.25
190 0.32
191 0.32
192 0.32
193 0.33
194 0.33
195 0.3
196 0.24
197 0.22
198 0.18
199 0.18
200 0.18
201 0.17
202 0.15
203 0.16
204 0.14
205 0.13
206 0.14
207 0.17
208 0.19
209 0.22
210 0.28
211 0.36
212 0.43
213 0.5
214 0.54
215 0.58
216 0.58
217 0.64
218 0.65
219 0.64
220 0.63
221 0.59
222 0.56
223 0.54
224 0.55
225 0.48
226 0.47
227 0.43
228 0.41
229 0.38
230 0.34
231 0.32
232 0.31
233 0.31
234 0.32
235 0.32
236 0.33
237 0.36
238 0.39
239 0.42
240 0.45
241 0.46
242 0.41
243 0.39
244 0.37
245 0.34
246 0.35
247 0.35
248 0.32
249 0.29
250 0.29
251 0.26
252 0.24
253 0.23
254 0.2
255 0.14
256 0.11
257 0.11
258 0.11
259 0.13
260 0.18
261 0.22
262 0.26
263 0.33
264 0.43
265 0.53
266 0.63
267 0.72
268 0.78
269 0.85
270 0.91