Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3LBQ3

Protein Details
Accession E3LBQ3    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
59-86GSEPLHHPNKKRPKRRPIRRGCGLEENRBasic
NLS Segment(s)
PositionSequence
55-78HKRAGSEPLHHPNKKRPKRRPIRR
Subcellular Location(s) nucl 9, mito 8, cyto 5, plas 2, extr 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011989  ARM-like  
IPR016024  ARM-type_fold  
KEGG pgr:PGTG_19578  -  
Amino Acid Sequences MLLLPSWSKLSRSVSQSTLLLSLGPQAFVRLGLDKINDQQNHHQHPDSDSSDSRHKRAGSEPLHHPNKKRPKRRPIRRGCGLEENRDRKRVLICFGSSRWNGQEFSGHLRVEIYRISQDFDQYIFGSVDANPVSLLTHLPRENSFSWLNSWPSWILKFVLGMFMTALRMARVAQEFPRLPPIYQWTRTSAREVTCTLLSEHCTQSVGHAVEPFLLAHGDHQVLNELVEALGDKLPAVSGAALSAVNSLVKIMTPWTRHLILRVLLNRIATASKWQVETGALKVLDVVVVSAAKKNAHAMPEFVPVLATAIWDTTADVKKAARSSLTKSFPVDAPTLSLMVNSNDYLEYSGIRLLSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.42
3 0.42
4 0.38
5 0.32
6 0.25
7 0.19
8 0.15
9 0.19
10 0.16
11 0.16
12 0.14
13 0.14
14 0.14
15 0.14
16 0.16
17 0.12
18 0.12
19 0.15
20 0.17
21 0.18
22 0.23
23 0.31
24 0.32
25 0.35
26 0.43
27 0.5
28 0.56
29 0.58
30 0.55
31 0.48
32 0.5
33 0.52
34 0.45
35 0.41
36 0.36
37 0.36
38 0.43
39 0.45
40 0.44
41 0.42
42 0.41
43 0.39
44 0.43
45 0.48
46 0.45
47 0.48
48 0.54
49 0.59
50 0.68
51 0.68
52 0.67
53 0.67
54 0.72
55 0.76
56 0.78
57 0.78
58 0.8
59 0.87
60 0.94
61 0.94
62 0.94
63 0.94
64 0.93
65 0.89
66 0.84
67 0.83
68 0.77
69 0.75
70 0.74
71 0.72
72 0.66
73 0.63
74 0.58
75 0.5
76 0.51
77 0.45
78 0.4
79 0.37
80 0.35
81 0.35
82 0.36
83 0.41
84 0.35
85 0.34
86 0.32
87 0.29
88 0.27
89 0.23
90 0.25
91 0.2
92 0.26
93 0.28
94 0.25
95 0.23
96 0.23
97 0.23
98 0.2
99 0.19
100 0.14
101 0.13
102 0.13
103 0.15
104 0.14
105 0.16
106 0.15
107 0.14
108 0.14
109 0.11
110 0.13
111 0.11
112 0.1
113 0.1
114 0.09
115 0.11
116 0.09
117 0.09
118 0.07
119 0.07
120 0.07
121 0.07
122 0.08
123 0.06
124 0.11
125 0.12
126 0.13
127 0.14
128 0.18
129 0.19
130 0.22
131 0.22
132 0.18
133 0.2
134 0.22
135 0.24
136 0.19
137 0.2
138 0.16
139 0.17
140 0.17
141 0.15
142 0.12
143 0.1
144 0.11
145 0.09
146 0.11
147 0.1
148 0.09
149 0.08
150 0.07
151 0.07
152 0.07
153 0.07
154 0.04
155 0.04
156 0.04
157 0.07
158 0.07
159 0.09
160 0.09
161 0.15
162 0.15
163 0.16
164 0.23
165 0.22
166 0.21
167 0.21
168 0.27
169 0.27
170 0.3
171 0.31
172 0.28
173 0.32
174 0.33
175 0.34
176 0.32
177 0.27
178 0.26
179 0.26
180 0.23
181 0.2
182 0.19
183 0.17
184 0.14
185 0.16
186 0.16
187 0.16
188 0.14
189 0.14
190 0.13
191 0.13
192 0.17
193 0.15
194 0.13
195 0.13
196 0.13
197 0.12
198 0.13
199 0.12
200 0.06
201 0.06
202 0.05
203 0.05
204 0.07
205 0.07
206 0.07
207 0.07
208 0.08
209 0.08
210 0.08
211 0.08
212 0.06
213 0.05
214 0.05
215 0.05
216 0.05
217 0.05
218 0.05
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.04
225 0.03
226 0.03
227 0.04
228 0.04
229 0.04
230 0.05
231 0.05
232 0.05
233 0.05
234 0.05
235 0.04
236 0.04
237 0.04
238 0.07
239 0.12
240 0.14
241 0.17
242 0.21
243 0.24
244 0.24
245 0.27
246 0.28
247 0.25
248 0.3
249 0.3
250 0.29
251 0.28
252 0.28
253 0.25
254 0.22
255 0.21
256 0.14
257 0.17
258 0.17
259 0.18
260 0.19
261 0.19
262 0.19
263 0.2
264 0.22
265 0.18
266 0.2
267 0.17
268 0.16
269 0.16
270 0.15
271 0.13
272 0.11
273 0.09
274 0.05
275 0.06
276 0.07
277 0.09
278 0.11
279 0.11
280 0.12
281 0.16
282 0.18
283 0.21
284 0.21
285 0.22
286 0.23
287 0.28
288 0.28
289 0.24
290 0.21
291 0.17
292 0.17
293 0.14
294 0.12
295 0.06
296 0.06
297 0.07
298 0.07
299 0.08
300 0.13
301 0.17
302 0.17
303 0.18
304 0.2
305 0.24
306 0.27
307 0.28
308 0.27
309 0.28
310 0.34
311 0.42
312 0.46
313 0.44
314 0.44
315 0.46
316 0.42
317 0.42
318 0.37
319 0.28
320 0.26
321 0.25
322 0.23
323 0.19
324 0.18
325 0.15
326 0.15
327 0.17
328 0.14
329 0.13
330 0.13
331 0.13
332 0.14
333 0.13
334 0.12
335 0.11
336 0.13