Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q2HG09

Protein Details
Accession Q2HG09    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
94-114EYLHYIPKYNRYEKRHKNLAAHydrophilic
NLS Segment(s)
PositionSequence
29-37SSRPGKGGR
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR032440  Ribosomal_S11_N  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
PF16205  Ribosomal_S17_N  
Amino Acid Sequences MATELTVQSERAFQKQPHIFLNSKTKVKSSRPGKGGRRWYKDVGLGFRTPTTAIEGQYIDKKCPFTGMVSIRGRILTGTVVSTKMHRTIIIRREYLHYIPKYNRYEKRHKNLAAHVSPGFPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.44
4 0.43
5 0.47
6 0.44
7 0.45
8 0.54
9 0.51
10 0.5
11 0.48
12 0.47
13 0.49
14 0.53
15 0.56
16 0.55
17 0.57
18 0.59
19 0.67
20 0.7
21 0.72
22 0.77
23 0.78
24 0.76
25 0.73
26 0.69
27 0.63
28 0.59
29 0.53
30 0.47
31 0.4
32 0.33
33 0.29
34 0.26
35 0.23
36 0.19
37 0.15
38 0.15
39 0.13
40 0.12
41 0.13
42 0.13
43 0.14
44 0.2
45 0.2
46 0.16
47 0.17
48 0.17
49 0.15
50 0.16
51 0.16
52 0.11
53 0.17
54 0.19
55 0.26
56 0.26
57 0.27
58 0.26
59 0.25
60 0.24
61 0.17
62 0.15
63 0.07
64 0.06
65 0.07
66 0.07
67 0.08
68 0.09
69 0.1
70 0.12
71 0.13
72 0.14
73 0.14
74 0.17
75 0.24
76 0.32
77 0.37
78 0.36
79 0.36
80 0.39
81 0.42
82 0.42
83 0.43
84 0.38
85 0.38
86 0.42
87 0.5
88 0.53
89 0.58
90 0.63
91 0.63
92 0.71
93 0.75
94 0.8
95 0.81
96 0.8
97 0.78
98 0.78
99 0.8
100 0.72
101 0.66
102 0.57