Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3K2F3

Protein Details
Accession E3K2F3    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
188-217IYLNKRYEKPFLKRRRLRSERHRRRFAIEVBasic
NLS Segment(s)
PositionSequence
193-212RYEKPFLKRRRLRSERHRRR
Subcellular Location(s) mito 11.5, mito_nucl 11.333, nucl 10, cyto_nucl 7.333, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001911  Ribosomal_S21  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pgr:PGTG_04478  -  
Pfam View protein in Pfam  
PF01165  Ribosomal_S21  
Amino Acid Sequences MSLINLRLLTAGRKATLGVVGSSSRSFSRGSNTCLSDADPFGFDRSQSSQSLKFRKPDTSPQQPTTQEIQPSDPKRTTDRSSSLLGGDIFRRMAENRQSQLQDLRRSDDRMKINREEKASLDQLWKSASQLKIQSHFGPLTPASSRVIRTVRIPPTSFLNRPVLASDVERSYKKLSSWLNAAGLRKEIYLNKRYEKPFLKRRRLRSERHRRRFAIEVQRRVQIINVMRMKGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.2
4 0.19
5 0.14
6 0.14
7 0.14
8 0.16
9 0.16
10 0.17
11 0.14
12 0.15
13 0.15
14 0.14
15 0.22
16 0.25
17 0.31
18 0.36
19 0.37
20 0.37
21 0.37
22 0.37
23 0.31
24 0.27
25 0.23
26 0.17
27 0.15
28 0.17
29 0.16
30 0.15
31 0.15
32 0.18
33 0.2
34 0.21
35 0.25
36 0.29
37 0.37
38 0.45
39 0.46
40 0.48
41 0.48
42 0.52
43 0.54
44 0.58
45 0.59
46 0.61
47 0.64
48 0.61
49 0.65
50 0.59
51 0.59
52 0.53
53 0.48
54 0.4
55 0.34
56 0.35
57 0.37
58 0.39
59 0.4
60 0.37
61 0.36
62 0.37
63 0.42
64 0.41
65 0.39
66 0.4
67 0.37
68 0.37
69 0.36
70 0.31
71 0.27
72 0.24
73 0.18
74 0.15
75 0.13
76 0.1
77 0.09
78 0.1
79 0.09
80 0.14
81 0.2
82 0.25
83 0.26
84 0.3
85 0.31
86 0.31
87 0.37
88 0.37
89 0.36
90 0.32
91 0.35
92 0.32
93 0.36
94 0.37
95 0.37
96 0.39
97 0.38
98 0.42
99 0.45
100 0.46
101 0.46
102 0.46
103 0.4
104 0.34
105 0.32
106 0.29
107 0.24
108 0.23
109 0.19
110 0.18
111 0.17
112 0.16
113 0.13
114 0.16
115 0.16
116 0.17
117 0.22
118 0.23
119 0.25
120 0.28
121 0.27
122 0.25
123 0.24
124 0.21
125 0.19
126 0.16
127 0.16
128 0.14
129 0.14
130 0.13
131 0.15
132 0.15
133 0.18
134 0.19
135 0.18
136 0.21
137 0.27
138 0.31
139 0.34
140 0.35
141 0.31
142 0.37
143 0.42
144 0.39
145 0.36
146 0.35
147 0.31
148 0.3
149 0.3
150 0.24
151 0.19
152 0.19
153 0.17
154 0.16
155 0.18
156 0.19
157 0.2
158 0.21
159 0.23
160 0.22
161 0.27
162 0.27
163 0.28
164 0.31
165 0.32
166 0.33
167 0.35
168 0.36
169 0.3
170 0.29
171 0.26
172 0.22
173 0.22
174 0.24
175 0.28
176 0.33
177 0.38
178 0.42
179 0.49
180 0.52
181 0.58
182 0.61
183 0.63
184 0.67
185 0.72
186 0.77
187 0.78
188 0.85
189 0.88
190 0.87
191 0.88
192 0.89
193 0.9
194 0.9
195 0.92
196 0.92
197 0.83
198 0.81
199 0.78
200 0.76
201 0.76
202 0.75
203 0.73
204 0.67
205 0.68
206 0.62
207 0.55
208 0.47
209 0.43
210 0.39
211 0.39
212 0.41