Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

H6QT29

Protein Details
Accession H6QT29    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
34-58DEENRKSDKKFKKKLQKLEQDYNESHydrophilic
NLS Segment(s)
PositionSequence
42-47KKFKKK
Subcellular Location(s) nucl 25.5, cyto_nucl 15
Family & Domain DBs
KEGG pgr:PGTG_21977  -  
Amino Acid Sequences MEGSSKEKIEEFEKSLGDIGQRIKELEAKANLLDEENRKSDKKFKKKLQKLEQDYNESNRILDEKANKLLREIENHYQGSPSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.23
4 0.2
5 0.18
6 0.17
7 0.17
8 0.17
9 0.17
10 0.17
11 0.2
12 0.21
13 0.23
14 0.22
15 0.2
16 0.2
17 0.2
18 0.19
19 0.16
20 0.17
21 0.14
22 0.16
23 0.17
24 0.19
25 0.19
26 0.21
27 0.3
28 0.37
29 0.45
30 0.52
31 0.59
32 0.68
33 0.76
34 0.86
35 0.87
36 0.87
37 0.84
38 0.84
39 0.8
40 0.76
41 0.7
42 0.63
43 0.55
44 0.45
45 0.37
46 0.27
47 0.24
48 0.17
49 0.19
50 0.2
51 0.21
52 0.29
53 0.33
54 0.33
55 0.33
56 0.39
57 0.38
58 0.39
59 0.42
60 0.42
61 0.45
62 0.46
63 0.45
64 0.41