Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3JPT9

Protein Details
Accession E3JPT9   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-42VTQVARKGRKALKVKKPPPAPREKMVNEHydrophilic
NLS Segment(s)
PositionSequence
20-38RKGRKALKVKKPPPAPREK
Subcellular Location(s) nucl 19, cyto_nucl 12, mito 5
Family & Domain DBs
KEGG pgr:PGTG_00424  -  
Amino Acid Sequences MKLYSPRRYGSQELVTQVARKGRKALKVKKPPPAPREKMVNENEKAKTIPSRDKSTELAESHEKEKDLAHEKAQSSMYPSSWRNLMGVPSNIYNSLLDTIKTRFPYRLTVSRTPEPTSQALVTVPKPTDSKTTSSASELSHPEEKSGKELSVVKLDHSKEETTLSQESDLSSIDKKQVAQAELTSLVNGILQPIVSRYLTPEKTTKLVDKSVRNKNVALRWVVNHVPTKFSNYFVREKIAPSFVKGFASWAAKTIMKFSSDHIFEVLQRHSIEFLAAINKANAHAAPHPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.44
3 0.4
4 0.39
5 0.38
6 0.33
7 0.31
8 0.37
9 0.4
10 0.49
11 0.57
12 0.64
13 0.68
14 0.76
15 0.82
16 0.84
17 0.87
18 0.88
19 0.87
20 0.87
21 0.83
22 0.78
23 0.8
24 0.74
25 0.73
26 0.71
27 0.7
28 0.63
29 0.64
30 0.58
31 0.5
32 0.47
33 0.4
34 0.38
35 0.36
36 0.42
37 0.41
38 0.48
39 0.49
40 0.52
41 0.52
42 0.5
43 0.5
44 0.41
45 0.4
46 0.37
47 0.37
48 0.36
49 0.36
50 0.32
51 0.25
52 0.26
53 0.28
54 0.29
55 0.28
56 0.29
57 0.33
58 0.33
59 0.36
60 0.36
61 0.29
62 0.27
63 0.27
64 0.25
65 0.24
66 0.24
67 0.22
68 0.22
69 0.23
70 0.19
71 0.18
72 0.19
73 0.18
74 0.19
75 0.19
76 0.18
77 0.18
78 0.18
79 0.17
80 0.15
81 0.11
82 0.12
83 0.1
84 0.1
85 0.11
86 0.13
87 0.16
88 0.18
89 0.19
90 0.18
91 0.2
92 0.26
93 0.3
94 0.36
95 0.39
96 0.44
97 0.49
98 0.52
99 0.53
100 0.5
101 0.46
102 0.42
103 0.35
104 0.3
105 0.24
106 0.19
107 0.17
108 0.16
109 0.15
110 0.15
111 0.14
112 0.14
113 0.14
114 0.15
115 0.2
116 0.2
117 0.22
118 0.22
119 0.24
120 0.23
121 0.24
122 0.25
123 0.2
124 0.21
125 0.19
126 0.19
127 0.21
128 0.2
129 0.2
130 0.21
131 0.2
132 0.19
133 0.19
134 0.16
135 0.14
136 0.17
137 0.17
138 0.2
139 0.2
140 0.18
141 0.23
142 0.23
143 0.22
144 0.22
145 0.21
146 0.16
147 0.18
148 0.17
149 0.15
150 0.16
151 0.15
152 0.13
153 0.13
154 0.12
155 0.11
156 0.1
157 0.08
158 0.08
159 0.09
160 0.11
161 0.12
162 0.12
163 0.14
164 0.18
165 0.17
166 0.18
167 0.17
168 0.16
169 0.17
170 0.17
171 0.13
172 0.09
173 0.08
174 0.08
175 0.07
176 0.06
177 0.04
178 0.04
179 0.04
180 0.05
181 0.07
182 0.07
183 0.07
184 0.11
185 0.19
186 0.2
187 0.23
188 0.26
189 0.26
190 0.29
191 0.32
192 0.33
193 0.29
194 0.35
195 0.39
196 0.45
197 0.51
198 0.59
199 0.63
200 0.6
201 0.58
202 0.57
203 0.57
204 0.52
205 0.47
206 0.4
207 0.35
208 0.37
209 0.37
210 0.35
211 0.35
212 0.31
213 0.31
214 0.29
215 0.36
216 0.32
217 0.34
218 0.36
219 0.35
220 0.4
221 0.37
222 0.41
223 0.34
224 0.36
225 0.36
226 0.36
227 0.32
228 0.3
229 0.32
230 0.29
231 0.29
232 0.27
233 0.25
234 0.23
235 0.26
236 0.22
237 0.2
238 0.22
239 0.22
240 0.23
241 0.25
242 0.22
243 0.2
244 0.21
245 0.22
246 0.28
247 0.27
248 0.27
249 0.25
250 0.24
251 0.24
252 0.29
253 0.28
254 0.23
255 0.22
256 0.22
257 0.21
258 0.2
259 0.18
260 0.14
261 0.14
262 0.13
263 0.14
264 0.15
265 0.14
266 0.15
267 0.15
268 0.17
269 0.15
270 0.15