Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3KSA8

Protein Details
Accession E3KSA8    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAKSLRSKSKRAFRATKRTSTSHydrophilic
NLS Segment(s)
PositionSequence
117-119RRR
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
KEGG pgr:PGTG_13402  -  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKSKRAFRATKRTSTSSDYQKTEAERLQRLSKKLTGSSAEGTEQAPDQEMQIAQGAENPDDSASKPAPKVTTHGPRMSGREVWKASKRGIQLRRAPSTTVWHQRSTGKPQRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.84
4 0.8
5 0.75
6 0.7
7 0.65
8 0.62
9 0.61
10 0.6
11 0.54
12 0.49
13 0.47
14 0.46
15 0.44
16 0.4
17 0.35
18 0.33
19 0.34
20 0.41
21 0.43
22 0.43
23 0.43
24 0.43
25 0.41
26 0.38
27 0.37
28 0.31
29 0.29
30 0.28
31 0.25
32 0.22
33 0.19
34 0.18
35 0.15
36 0.12
37 0.09
38 0.08
39 0.07
40 0.06
41 0.07
42 0.06
43 0.06
44 0.07
45 0.07
46 0.06
47 0.08
48 0.08
49 0.07
50 0.08
51 0.07
52 0.06
53 0.07
54 0.08
55 0.09
56 0.09
57 0.11
58 0.12
59 0.14
60 0.16
61 0.16
62 0.19
63 0.24
64 0.33
65 0.36
66 0.38
67 0.39
68 0.4
69 0.44
70 0.44
71 0.4
72 0.34
73 0.37
74 0.37
75 0.4
76 0.44
77 0.43
78 0.43
79 0.43
80 0.45
81 0.47
82 0.52
83 0.55
84 0.57
85 0.62
86 0.67
87 0.63
88 0.6
89 0.53
90 0.54
91 0.54
92 0.55
93 0.51
94 0.46
95 0.47
96 0.53
97 0.57
98 0.6
99 0.61