Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3KBE3

Protein Details
Accession E3KBE3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
12-34RDPFANKRPSARKNIGANRRPPHHydrophilic
NLS Segment(s)
PositionSequence
18-34KRPSARKNIGANRRPPH
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013226  Pal1  
Gene Ontology GO:0005737  C:cytoplasm  
KEGG pgr:PGTG_07905  -  
Pfam View protein in Pfam  
PF08316  Pal1  
Amino Acid Sequences MSTTTTNLQESRDPFANKRPSARKNIGANRRPPHPSNPNQNSSRKQTKAPASGGSNPKKSSSHGALDFIDTLDTIGGFHHDGPFDAASSHRNRHMNSKNPSRQAPMAAFDPSALILPPPPPASAPAPVSLASQDHVYPPAIPRRASDNTMPVSMGYPAGTIAADPKAARLAEAFGIQGKEAWEDFGMEHAIEEGSTGGGGLLGHRRGTSREQRDAKSASVWDMEETLKSGKPVPSAYTPRSEASARGANGELERQATNAAQLKRSKSLMQRIRRGQVAQPTDGDALLVDIWGLHEYEELRSIPPSFSMTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.48
3 0.55
4 0.53
5 0.6
6 0.64
7 0.65
8 0.71
9 0.75
10 0.74
11 0.74
12 0.81
13 0.82
14 0.8
15 0.81
16 0.76
17 0.76
18 0.74
19 0.68
20 0.68
21 0.67
22 0.68
23 0.7
24 0.74
25 0.75
26 0.75
27 0.8
28 0.76
29 0.75
30 0.76
31 0.68
32 0.64
33 0.64
34 0.66
35 0.66
36 0.62
37 0.59
38 0.54
39 0.59
40 0.64
41 0.63
42 0.59
43 0.52
44 0.52
45 0.48
46 0.45
47 0.45
48 0.41
49 0.4
50 0.37
51 0.38
52 0.36
53 0.36
54 0.33
55 0.25
56 0.2
57 0.12
58 0.1
59 0.07
60 0.06
61 0.05
62 0.04
63 0.05
64 0.06
65 0.07
66 0.08
67 0.08
68 0.09
69 0.11
70 0.11
71 0.1
72 0.1
73 0.1
74 0.14
75 0.18
76 0.21
77 0.25
78 0.28
79 0.29
80 0.39
81 0.47
82 0.52
83 0.56
84 0.64
85 0.66
86 0.67
87 0.69
88 0.63
89 0.56
90 0.5
91 0.43
92 0.35
93 0.29
94 0.25
95 0.22
96 0.17
97 0.16
98 0.12
99 0.1
100 0.07
101 0.05
102 0.05
103 0.06
104 0.08
105 0.09
106 0.09
107 0.09
108 0.12
109 0.14
110 0.16
111 0.17
112 0.16
113 0.16
114 0.16
115 0.16
116 0.14
117 0.12
118 0.1
119 0.09
120 0.08
121 0.08
122 0.08
123 0.08
124 0.09
125 0.11
126 0.17
127 0.19
128 0.19
129 0.19
130 0.25
131 0.27
132 0.29
133 0.28
134 0.26
135 0.25
136 0.25
137 0.24
138 0.18
139 0.16
140 0.13
141 0.12
142 0.07
143 0.05
144 0.05
145 0.05
146 0.04
147 0.04
148 0.05
149 0.05
150 0.05
151 0.05
152 0.06
153 0.08
154 0.08
155 0.08
156 0.07
157 0.08
158 0.08
159 0.08
160 0.08
161 0.07
162 0.08
163 0.08
164 0.08
165 0.07
166 0.08
167 0.07
168 0.08
169 0.06
170 0.07
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.06
177 0.05
178 0.05
179 0.05
180 0.04
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.04
188 0.07
189 0.08
190 0.09
191 0.09
192 0.1
193 0.13
194 0.21
195 0.3
196 0.34
197 0.43
198 0.48
199 0.5
200 0.55
201 0.55
202 0.48
203 0.41
204 0.35
205 0.27
206 0.23
207 0.21
208 0.16
209 0.15
210 0.14
211 0.12
212 0.12
213 0.12
214 0.11
215 0.12
216 0.16
217 0.16
218 0.18
219 0.2
220 0.22
221 0.29
222 0.34
223 0.36
224 0.38
225 0.39
226 0.37
227 0.38
228 0.35
229 0.28
230 0.27
231 0.31
232 0.25
233 0.25
234 0.25
235 0.23
236 0.23
237 0.24
238 0.19
239 0.15
240 0.15
241 0.13
242 0.13
243 0.12
244 0.16
245 0.21
246 0.23
247 0.26
248 0.31
249 0.35
250 0.38
251 0.41
252 0.42
253 0.43
254 0.52
255 0.56
256 0.61
257 0.67
258 0.7
259 0.73
260 0.72
261 0.67
262 0.62
263 0.62
264 0.57
265 0.5
266 0.43
267 0.41
268 0.36
269 0.33
270 0.27
271 0.17
272 0.13
273 0.1
274 0.09
275 0.05
276 0.04
277 0.05
278 0.06
279 0.06
280 0.05
281 0.07
282 0.09
283 0.1
284 0.14
285 0.14
286 0.15
287 0.17
288 0.18
289 0.17
290 0.18